ESRG (embryonic stem cell related)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 790952
Gene name Embryonic stem cell related
Gene symbol ESRG
Synonyms (NCBI Gene)
HESRG
Chromosome 3
Chromosome location 3p14.3|3p14.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IDA 23628413
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611473 39079 ENSG00000265992
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q1W209
Protein name Embryonic stem cell-related gene protein (hES cell-related gene protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed only in fetal ovary and in undifferentiated ES cells. {ECO:0000269|PubMed:17803967, ECO:0000269|PubMed:23628413}.
Sequence 
MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSV
RKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNF
NSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPL
AASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP
Sequence length 222
Interactions View interactions

No strongly related genes found yet for ESRG.

No additional diseases found yet through genes similar to ESRG.