ESCO1 (establishment of sister chromatid cohesion N-acetyltransferase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 114799
• Gene name: Establishment of sister chromatid cohesion N-acetyltransferase 1
• Gene symbol: ESCO1
• Synonyms (NCBI Gene): A930014I12Rik, CTF, ECO1, EFO1, ESO1
• Chromosome: 18
• Chromosome location: 18q11.2
• Summary: ESCO1 belongs to a conserved family of acetyltransferases involved in sister chromatid cohesion (Hou and Zou, 2005 [PubMed 15958495]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT711514	hsa-miR-216a-5p	HITS-CLIP	19536157
MIRT711513	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT711512	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT711511	hsa-miR-3065-3p	HITS-CLIP	19536157
MIRT711510	hsa-miR-383-3p	HITS-CLIP	19536157
MIRT711509	hsa-miR-5693	HITS-CLIP	19536157
MIRT711508	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT711507	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT711506	hsa-miR-6499-3p	HITS-CLIP	19536157
MIRT711505	hsa-miR-4284	HITS-CLIP	19536157
MIRT711504	hsa-miR-24-3p	HITS-CLIP	19536157
MIRT711503	hsa-miR-143-5p	HITS-CLIP	19536157
MIRT711514	hsa-miR-216a-5p	HITS-CLIP	19536157
MIRT711513	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT711512	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT711511	hsa-miR-3065-3p	HITS-CLIP	19536157
MIRT711510	hsa-miR-383-3p	HITS-CLIP	19536157
MIRT711509	hsa-miR-5693	HITS-CLIP	19536157
MIRT711508	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT711507	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT711506	hsa-miR-6499-3p	HITS-CLIP	19536157
MIRT711505	hsa-miR-4284	HITS-CLIP	19536157
MIRT711504	hsa-miR-24-3p	HITS-CLIP	19536157
MIRT711503	hsa-miR-143-5p	HITS-CLIP	19536157
MIRT970133	hsa-miR-1305	CLIP-seq
MIRT970134	hsa-miR-3163	CLIP-seq
MIRT970135	hsa-miR-323-3p	CLIP-seq
MIRT970136	hsa-miR-421	CLIP-seq
MIRT970137	hsa-miR-4328	CLIP-seq
MIRT970138	hsa-miR-4528	CLIP-seq
MIRT970139	hsa-miR-4717-5p	CLIP-seq
MIRT970140	hsa-miR-4753-5p	CLIP-seq
MIRT970141	hsa-miR-4778-3p	CLIP-seq
MIRT970142	hsa-miR-552	CLIP-seq
MIRT1922721	hsa-miR-1252	CLIP-seq
MIRT1922722	hsa-miR-3616-3p	CLIP-seq
MIRT1922723	hsa-miR-3646	CLIP-seq
MIRT1922724	hsa-miR-3662	CLIP-seq
MIRT1922725	hsa-miR-4698	CLIP-seq
MIRT1987517	hsa-miR-1200	CLIP-seq
MIRT1987518	hsa-miR-1202	CLIP-seq
MIRT1987519	hsa-miR-1236	CLIP-seq
MIRT1987520	hsa-miR-1910	CLIP-seq
MIRT1987521	hsa-miR-2054	CLIP-seq
MIRT1987522	hsa-miR-3124-3p	CLIP-seq
MIRT1987523	hsa-miR-323b-5p	CLIP-seq
MIRT1987524	hsa-miR-3972	CLIP-seq
MIRT1987525	hsa-miR-4289	CLIP-seq
MIRT1987526	hsa-miR-4324	CLIP-seq
MIRT1987527	hsa-miR-4423-5p	CLIP-seq
MIRT1987528	hsa-miR-4633-3p	CLIP-seq
MIRT1987529	hsa-miR-4682	CLIP-seq
MIRT1987530	hsa-miR-4686	CLIP-seq
MIRT1987531	hsa-miR-4753-3p	CLIP-seq
MIRT1987532	hsa-miR-544b	CLIP-seq
MIRT1987533	hsa-miR-576-3p	CLIP-seq
MIRT1987534	hsa-miR-584	CLIP-seq
MIRT1987520	hsa-miR-1910	CLIP-seq
MIRT2221958	hsa-miR-30a	CLIP-seq
MIRT2221959	hsa-miR-30b	CLIP-seq
MIRT2221960	hsa-miR-30c	CLIP-seq
MIRT2221961	hsa-miR-30d	CLIP-seq
MIRT2221962	hsa-miR-30e	CLIP-seq
MIRT2221963	hsa-miR-337-3p	CLIP-seq
MIRT2221964	hsa-miR-4495	CLIP-seq
MIRT2221965	hsa-miR-455-3p	CLIP-seq
MIRT1987530	hsa-miR-4686	CLIP-seq
MIRT2525613	hsa-miR-186	CLIP-seq
MIRT1987520	hsa-miR-1910	CLIP-seq
MIRT2221958	hsa-miR-30a	CLIP-seq
MIRT2221959	hsa-miR-30b	CLIP-seq
MIRT2221960	hsa-miR-30c	CLIP-seq
MIRT2221961	hsa-miR-30d	CLIP-seq
MIRT2221962	hsa-miR-30e	CLIP-seq
MIRT1987522	hsa-miR-3124-3p	CLIP-seq
MIRT970134	hsa-miR-3163	CLIP-seq
MIRT2525614	hsa-miR-33a	CLIP-seq
MIRT2525615	hsa-miR-33b	CLIP-seq
MIRT2525616	hsa-miR-3685	CLIP-seq
MIRT2525617	hsa-miR-384	CLIP-seq
MIRT2525618	hsa-miR-4266	CLIP-seq
MIRT2221964	hsa-miR-4495	CLIP-seq
MIRT2525619	hsa-miR-4540	CLIP-seq
MIRT2221965	hsa-miR-455-3p	CLIP-seq
MIRT1987530	hsa-miR-4686	CLIP-seq
MIRT2525620	hsa-miR-4695-5p	CLIP-seq
MIRT2525621	hsa-miR-4779	CLIP-seq
MIRT2525622	hsa-miR-4786-5p	CLIP-seq
MIRT2525623	hsa-miR-4799-5p	CLIP-seq
MIRT2525624	hsa-miR-502-5p	CLIP-seq
MIRT2525625	hsa-miR-577	CLIP-seq
MIRT2525626	hsa-miR-769-5p	CLIP-seq
MIRT2525613	hsa-miR-186	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	19907496
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IDA	15958495
GO:0005694	Component	Chromosome	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	19907496
GO:0007062	Process	Sister chromatid cohesion	TAS
GO:0007064	Process	Mitotic sister chromatid cohesion	IBA
GO:0008080	Function	N-acetyltransferase activity	IDA	27803161
GO:0008080	Function	N-acetyltransferase activity	TAS
GO:0008270	Function	Zinc ion binding	IDA	27803161
GO:0008270	Function	Zinc ion binding	IEA
GO:0016407	Function	Acetyltransferase activity	IDA	15958495
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0018394	Process	Peptidyl-lysine acetylation	IDA	27112597
GO:0034421	Process	Post-translational protein acetylation	IMP	21111234, 27803161
GO:0042802	Function	Identical protein binding	IPI	27112597
GO:0046872	Function	Metal ion binding	IEA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IBA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IDA	27112597
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA

Other IDs

• MIM: 609674
• HGNC: 24645
• e!Ensembl: ENSG00000141446

Protein

• UniProt ID: Q5FWF5
• Protein name: N-acetyltransferase ESCO1 (EC 2.3.1.-) (CTF7 homolog 1) (Establishment factor-like protein 1) (EFO1) (EFO1p) (hEFO1) (Establishment of cohesion 1 homolog 1) (ECO1 homolog 1) (ESO1 homolog 1)
• Protein function: Acetyltransferase required for the establishment of sister chromatid cohesion (PubMed:15958495, PubMed:18614053). Couples the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. In contrast to
• PDB: 4MXE , 5T53
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13878	zf-C2H2_3	604 → 643	zinc-finger of acetyl-transferase ESCO	Domain
  PF13880	Acetyltransf_13	763 → 831	ESCO1/2 acetyl-transferase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in heart, brain, liver, placenta, lung, kidney and pancreas. Highly expressed in muscle. {ECO:0000269|PubMed:14576321}.
• Sequence:

  MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQP
  ELETRMSTRSSKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNR
  RSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVL
  EVKSDSKEDENLVINEVINSPKGKKRKVEHQTACACSSQCTQGSEKCPQKTTRRDETKPV
  PVTSEVKRSKMATSVVPKKNEMKKSVHTQVNTNTTLPKSPQPSVPEQSDNELEQAGKSKR
  GSILQLCEEIAGEIESDNVEVKKESSQMESVKEEKPTEIKLEETSVERQILHQKETNQDV
  QCNRFFPSRKTKPVKCILNGINSSAKKNSNWTKIKLSKFNSVQHNKLDSQVSPKLGLLRT
  SFSPPALEMHHPVTQSTFLGTKLHDRNITCQQEKMKEINSEEVKINDITVEINKTTERAP
  ENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKI
  DTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEITIPKDLKLKEAEKT
  DEKQLIIDAGQKRFGAVSCNVCGMLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILA
  EYPDGRIIMVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVG
  CLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRR
  KKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST
  

• Sequence length: 840

Pathways

KEGG Pathway:

Cell cycle

Reactome Pathway:

Establishment of Sister Chromatid Cohesion

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ESCO2 2 shared pathwaysCell cycle, Establishment of Sister Chromatid Cohesion Related via 2 shared pathways including Cell cycle, Establishment of Sister Chromatid Cohesion. CDCA5 2 shared pathwaysCell cycle, Establishment of Sister Chromatid Cohesion Related via 2 shared pathways including Cell cycle, Establishment of Sister Chromatid Cohesion. PDS5B 2 shared pathwaysCell cycle, Establishment of Sister Chromatid Cohesion Related via 2 shared pathways including Cell cycle, Establishment of Sister Chromatid Cohesion. WAPL 2 shared pathwaysCell cycle, Establishment of Sister Chromatid Cohesion Related via 2 shared pathways including Cell cycle, Establishment of Sister Chromatid Cohesion. PDS5A 2 shared pathwaysCell cycle, Establishment of Sister Chromatid Cohesion Related via 2 shared pathways including Cell cycle, Establishment of Sister Chromatid Cohesion.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ESCO2	0	[]	2	["Cell cycle","Establishment of Sister Chromatid Cohesion"]	0	[]
CDCA5	0	[]	2	["Cell cycle","Establishment of Sister Chromatid Cohesion"]	0	[]
PDS5B	0	[]	2	["Cell cycle","Establishment of Sister Chromatid Cohesion"]	0	[]
WAPL	0	[]	2	["Cell cycle","Establishment of Sister Chromatid Cohesion"]	0	[]
PDS5A	0	[]	2	["Cell cycle","Establishment of Sister Chromatid Cohesion"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 3 of 5 related genesCDCA5, PDS5B, WAPL Cardiovascular disease Linked via 2 of 5 related genesCDCA5, WAPL Metabolic syndrome Linked via 2 of 5 related genesCDCA5, PDS5B Color vision deficiency Linked via 2 of 5 related genesWAPL, PDS5A Cleft lip/palate with abnormal thumbs and microcephaly Linked via 1 of 5 related genesESCO2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	3	["CDCA5","PDS5B","WAPL"]
Cardiovascular disease	2	["CDCA5","WAPL"]
Metabolic syndrome	2	["CDCA5","PDS5B"]
Color vision deficiency	2	["WAPL","PDS5A"]
Cleft lip/palate with abnormal thumbs and microcephaly	1	["ESCO2"]