ERVK13-1 (endogenous retrovirus group K13 member 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100507321
Gene name Endogenous retrovirus group K13 member 1
Gene symbol ERVK13-1
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005198 Function Structural molecule activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 27548 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NX77
Protein name Endogenous retrovirus group K member 13-1 Env polyprotein (Envelope polyprotein) (HERV-K_16p13.3 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)]
Protein function Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution (By similarity). ; FUNCTION
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00517 GP41 310 → 482 Family
PF13804 HERV-K_env_2 4 → 109 Domain
Tissue specificity TISSUE SPECIFICITY: Primary culture of CD34+, lung, thymus, ileal mucosa, small intestine, and testis.
Sequence 
MWTVPSFTNDSYQVYNVFSTNSFQLLTVKRTPHEAWRVPLTTKTNKTKGLPDCPKKPTNG
PFIVTSILWDNCNAPKAVVLQTLAMGIVIDWAPKGHYWQDCSSKNTLCSEFIYSLDYIEH
GWQSYTMRQRVSPYPFKWMDTGIAPPRPKIIHPFFTPEHPELWKLAAALSGIKIWNTTYQ
LLRTKTKTPTFNITLISEWVIPIRSCVKPPYMLLVGNIIMMPDAQTIECHNCKLFTCIDA
TFNPTTSILLVRAREGVWIPVSLHRPWESSPSIHIVNEVLKDILKRTKRFIFTLIAVLAG
LLAVTATAATAGVAIRSSVQTAHYVEACQKNSSRLWNSQAQIDQKLANQINDLRQSVTWL
GDRVMNLQHRMQLQCDWNTSDYCITPYAYNQDQHSWENVSRHLKAWDDNLTLDISQLKEQ
IFEASQAHLSTVPGSHIFEGITKQLPDFNPFKWLKPVRGSLLLLALLILVCLCCLLLVCR
CL
Sequence length 482
Interactions View interactions

No strongly related genes found yet for ERVK13-1.

No additional diseases found yet through genes similar to ERVK13-1.