ERVK11-1 (endogenous retrovirus group K11 member 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100859922
Gene name Endogenous retrovirus group K11 member 1
Gene symbol ERVK11-1
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p13.3
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P61568
Protein name Putative endogenous retrovirus group K member 11-1 Env polyprotein (Envelope polyprotein) (HERV-K_1p13.3 provirus ancestral Env polyprotein) [Includes: Truncated surface protein (SU)]
Protein function Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13804 HERV-K_env_2 1 → 146 Domain
Tissue specificity TISSUE SPECIFICITY: Cerebellum and testis.
Sequence 
MPGAIDDHCPAQPGEEGTAFNVTMGYKYPPLCLGHATRCIHLETQVWAAYLLERLATGKW
GHLVSGLSLCPLRQMKRGVIGDTPYFQYKPVGKLCPKNFEGPSKTLIWGDCVNSHAVVLK
NDSYALVIDWAPKGYLKNTCSSGGGEFLEATYFISYWEDEDHHPTLHRWFGSFFTLKWED
KDITLHPQGLV
Sequence length 191
Interactions View interactions

No strongly related genes found yet for ERVK11-1.

No additional diseases found yet through genes similar to ERVK11-1.