ERVK-16 (endogenous retrovirus group K member 16)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100616411
Gene name Endogenous retrovirus group K member 16
Gene symbol ERVK-16
Synonyms (NCBI Gene)
M3.8c10_A
Chromosome 10
Chromosome location 10p14
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0005730 Component Nucleolus IEA
GO:0005737 Component Cytoplasm IEA
GO:0051028 Process MRNA transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P61578
Protein name Endogenous retrovirus group K member 16 Rec protein (HERV-K_10p14 provirus Rec protein)
Protein function Retroviral replication requires the nuclear export and translation of unspliced, singly-spliced and multiply-spliced derivatives of the initial genomic transcript. Rec interacts with a highly structured RNA element (RcRE) present in the viral 3'
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15695 HERV-K_REC 19 → 105 Family
Sequence 
MNPSEMQRKAPPRRRRHRNRAPSSHKMNKMMMSEEQMKLPSTNKAEPLTWAQLNKLTQLA
TKCLENTKMTQTPESMLLAALMIVSTVSAGVPNSSEETVTIENGP
Sequence length 105
Interactions View interactions

No strongly related genes found yet for ERVK-16.

No additional diseases found yet through genes similar to ERVK-16.