ERVFRD-1 (endogenous retrovirus group FRD member 1, envelope)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 405754
Gene name Endogenous retrovirus group FRD member 1, envelope
Gene symbol ERVFRD-1
Synonyms (NCBI Gene)
ERVFRDE1GLLL6191HERV-FRDHERV-W/FRDUNQ6191envFRD
Chromosome 6
Chromosome location 6p24.2
Summary Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of a human endogenous retrovirus provirus on chromosome
miRNA miRNA information provided by mirtarbase database.
14 Show/Hide all (14)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT970086 hsa-miR-1226 CLIP-seq
MIRT970087 hsa-miR-361-5p CLIP-seq
MIRT970088 hsa-miR-4312 CLIP-seq
MIRT970089 hsa-miR-4733-3p CLIP-seq
MIRT970090 hsa-miR-4747-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Download as csvDownload as pdf
Transcription factor Regulation Reference
GCM1 Unknown 20484742
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000768 Process Syncytium formation by plasma membrane fusion IBA
GO:0000768 Process Syncytium formation by plasma membrane fusion IDA 14557543
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
GO:0006949 Process Syncytium formation IDA 23492904
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610524 33823 ENSG00000244476
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P60508
Protein name Syncytin-2 (Endogenous retrovirus group FRD member 1) (Envelope polyprotein) (HERV-FRD) (HERV-FRD_6p24.1 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)]
Protein function This endogenous retroviral envelope protein has retained its original fusogenic properties and participates in trophoblast fusion and the formation of a syncytium during placenta morphogenesis. The interaction with MFSD2A is apparently important
PDB 1Y4M , 6RX3 , 7OIX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00429 TLV_coat 211 → 512 ENV polyprotein (coat polyprotein) Family
Tissue specificity TISSUE SPECIFICITY: Expressed at higher level in placenta. Expressed at lower level in adrenal, bone marrow, brain, breast, colon, kidney, lung, ovary, peripheral blood lymphocytes, prostate, skin, spleen, testis, thymus, thyroid, trachea. {ECO:0000269|Pu
Sequence 
MGLLLLVLILTPSLAAYRHPDFPLLEKAQQLLQSTGSPYSTNCWLCTSSSTETPGTAYPA
SPREWTSIEAELHISYRWDPNLKGLMRPANSLLSTVKQDFPDIRQKPPIFGPIFTNINLM
GIAPICVMAKRKNGTNVGTLPSTVCNVTFTVDSNQQTYQTYTHNQFRHQPRFPKPPNITF
PQGTLLDKSSRFCQGRPSSCSTRNFWFRPADYNQCLQISNLSSTAEWVLLDQTRNSLFWE
NKTKGANQSQTPCVQVLAGMTIATSYLGISAVSEFFGTSLTPLFHFHISTCLKTQGAFYI
CGQSIHQCLPSNWTGTCTIGYVTPDIFIAPGNLSLPIPIYGNSPLPRVRRAIHFIPLLAG
LGILAGTGTGIAGITKASLTYSQLSKEIANNIDTMAKALTTMQEQIDSLAAVVLQNRRGL
DMLTAAQGGICLALDEKCCFWVNQSGKVQDNIRQLLNQASSLRERATQGWLNWEGTWKWF
SWVLPLTGPLVSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF
Sequence length 538
Interactions View interactions

No strongly related genes found yet for ERVFRD-1.

No additional diseases found yet through genes similar to ERVFRD-1.