Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	57471
Gene name	Ermin
Gene symbol	ERMN
Synonyms (NCBI Gene)	JNKIAA1189
Chromosome	2
Chromosome location	2q24.1

64 Show/Hide all (64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023843	hsa-miR-1-3p	Microarray	18668037
MIRT047642	hsa-miR-10a-5p	CLASH	23622248
MIRT969507	hsa-miR-1304	CLIP-seq
MIRT969508	hsa-miR-1324	CLIP-seq
MIRT969509	hsa-miR-154	CLIP-seq
MIRT969510	hsa-miR-2114	CLIP-seq
MIRT969511	hsa-miR-224	CLIP-seq
MIRT969512	hsa-miR-3157-5p	CLIP-seq
MIRT969513	hsa-miR-361-5p	CLIP-seq
MIRT969514	hsa-miR-3976	CLIP-seq
MIRT969515	hsa-miR-4305	CLIP-seq
MIRT969516	hsa-miR-4461	CLIP-seq
MIRT969517	hsa-miR-4494	CLIP-seq
MIRT969518	hsa-miR-4499	CLIP-seq
MIRT969519	hsa-miR-4536	CLIP-seq
MIRT969520	hsa-miR-4653-3p	CLIP-seq
MIRT969521	hsa-miR-4680-3p	CLIP-seq
MIRT969522	hsa-miR-4693-3p	CLIP-seq
MIRT969523	hsa-miR-4759	CLIP-seq
MIRT969524	hsa-miR-4802-3p	CLIP-seq
MIRT969525	hsa-miR-499a-5p	CLIP-seq
MIRT969526	hsa-miR-5096	CLIP-seq
MIRT969527	hsa-miR-656	CLIP-seq
MIRT1548425	hsa-miR-1273f	CLIP-seq
MIRT1548426	hsa-miR-185	CLIP-seq
MIRT1548427	hsa-miR-196a	CLIP-seq
MIRT1548428	hsa-miR-196b	CLIP-seq
MIRT1548429	hsa-miR-3175	CLIP-seq
MIRT1548430	hsa-miR-3927	CLIP-seq
MIRT1548431	hsa-miR-4278	CLIP-seq
MIRT1548432	hsa-miR-4306	CLIP-seq
MIRT1548433	hsa-miR-4644	CLIP-seq
MIRT1548434	hsa-miR-4716-3p	CLIP-seq
MIRT1548435	hsa-miR-4723-5p	CLIP-seq
MIRT1987341	hsa-miR-3646	CLIP-seq
MIRT1987342	hsa-miR-1267	CLIP-seq
MIRT1987343	hsa-miR-3673	CLIP-seq
MIRT1987344	hsa-miR-888	CLIP-seq
MIRT969507	hsa-miR-1304	CLIP-seq
MIRT969509	hsa-miR-154	CLIP-seq
MIRT2221794	hsa-miR-3124-3p	CLIP-seq
MIRT969513	hsa-miR-361-5p	CLIP-seq
MIRT2221795	hsa-miR-3685	CLIP-seq
MIRT2221796	hsa-miR-384	CLIP-seq
MIRT2221797	hsa-miR-511	CLIP-seq
MIRT2221798	hsa-miR-520d-5p	CLIP-seq
MIRT2221799	hsa-miR-524-5p	CLIP-seq
MIRT2221800	hsa-miR-548u	CLIP-seq
MIRT969508	hsa-miR-1324	CLIP-seq
MIRT2437091	hsa-miR-181a	CLIP-seq
MIRT2437092	hsa-miR-181b	CLIP-seq
MIRT2437093	hsa-miR-181c	CLIP-seq
MIRT2437094	hsa-miR-181d	CLIP-seq
MIRT2437095	hsa-miR-219-2-3p	CLIP-seq
MIRT2437096	hsa-miR-4262	CLIP-seq
MIRT2221797	hsa-miR-511	CLIP-seq
MIRT2448948	hsa-miR-3606	CLIP-seq
MIRT2448949	hsa-miR-4670-3p	CLIP-seq
MIRT2448950	hsa-miR-577	CLIP-seq
MIRT2448951	hsa-miR-921	CLIP-seq
MIRT2448948	hsa-miR-3606	CLIP-seq
MIRT2448949	hsa-miR-4670-3p	CLIP-seq
MIRT2448950	hsa-miR-577	CLIP-seq
MIRT2448951	hsa-miR-921	CLIP-seq

36 Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001763	Process	Morphogenesis of a branching structure	IBA
GO:0001763	Process	Morphogenesis of a branching structure	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IDA	20934411
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005938	Component	Cell cortex	IBA
GO:0005938	Component	Cell cortex	IDA	20934411
GO:0007015	Process	Actin filament organization	IBA
GO:0007015	Process	Actin filament organization	IDA	20934411
GO:0007015	Process	Actin filament organization	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0008360	Process	Regulation of cell shape	IBA
GO:0008360	Process	Regulation of cell shape	IDA	20934411
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0030175	Component	Filopodium	IBA
GO:0030175	Component	Filopodium	IEA
GO:0031344	Process	Regulation of cell projection organization	IBA
GO:0031344	Process	Regulation of cell projection organization	IDA	20934411
GO:0031344	Process	Regulation of cell projection organization	IEA
GO:0033269	Component	Internode region of axon	IBA
GO:0033269	Component	Internode region of axon	IDA	20934411
GO:0033269	Component	Internode region of axon	IEA
GO:0033270	Component	Paranode region of axon	IBA
GO:0033270	Component	Paranode region of axon	IDA	20934411
GO:0033270	Component	Paranode region of axon	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043209	Component	Myelin sheath	IBA
GO:0043209	Component	Myelin sheath	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097386	Component	Glial cell projection	IEA

MIM	HGNC	e!Ensembl
610072	29208	ENSG00000136541

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8TAM6
Protein name	Ermin (Juxtanodin) (JN)
Protein function	Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia matur
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Highly expressed in adult and fetal brain. Expressed at intermediate levels in the lung and liver. {ECO:0000269\|PubMed:10574461}.
Sequence	MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEE RRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPL SGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQK VWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDE QPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHL
Sequence length	284
Interactions	View interactions

Related Genes Genes most often co-reported with ERMN across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ERMN.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ERMN (see Related Genes above), that are NOT already directly curated for ERMN itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ERMN.

ERMN (ermin)

Bookmark This Gene