ERLN (endoregulin)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100130933 |
| Gene name | Endoregulin |
| Gene symbol | ERLN |
| Synonyms (NCBI Gene) |
C17orf110ELNSMIM6
|
| Chromosome | 17 |
| Chromosome location | 17q25.1 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
|
|||||||||||||||||||||
|
|||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0DI80 |
| Protein name | Endoregulin (ELN) (Small integral membrane protein 6) |
| Protein function | Inhibits the activity of the calcium ATPases ATP2A2/SERCA2 and ATP2A3/SERCA3 by decreasing their apparent affinity for Ca(2+). |
| Family and domains | |
| Sequence |
MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGE |
| Sequence length | 62 |
| Interactions | View interactions |
|
Pathways
Pathway information has different metabolic/signaling pathways associated with genes.
|
|||
|
|||
|
Related Genes
Genes most often co-reported with ERLN across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ERLN (see Related Genes above), that are NOT already directly curated for ERLN itself -- a lead worth checking, not a confirmed association.
0
|
|