Gene Gene information from NCBI Gene database.
Entrez ID 11160
Gene name ER lipid raft associated 2
Gene symbol ERLIN2
Synonyms (NCBI Gene)
C8orf2Erlin-2NET32SPFH2SPG18SPG18ASPG18B
Chromosome 8
Chromosome location 8p11.23
Summary This gene encodes a member of the SPFH domain-containing family of lipid raft-associated proteins. The encoded protein is localized to lipid rafts of the endoplasmic reticulum and plays a critical role in inositol 1,4,5-trisphosphate (IP3) signaling by me
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs587776893 ->AC Pathogenic Genic downstream transcript variant, frameshift variant, coding sequence variant
rs763958615 A>G,T Likely-pathogenic Coding sequence variant, missense variant, genic downstream transcript variant
rs1057519172 G>A Likely-pathogenic Splice acceptor variant
rs1585907153 A>- Pathogenic Coding sequence variant, frameshift variant
rs1585919102 ->GGCCATTGCTTCCA Likely-pathogenic Coding sequence variant, frameshift variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
577
miRTarBase ID miRNA Experiments Reference
MIRT004154 hsa-miR-192-5p Microarray 16822819
MIRT025281 hsa-miR-34a-5p Proteomics 21566225
MIRT025281 hsa-miR-34a-5p Proteomics 21566225
MIRT025281 hsa-miR-34a-5p Proteomics 21566225
MIRT031903 hsa-miR-16-5p Proteomics 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19240031, 21343306, 22119785, 30021884, 30352685, 33961781
GO:0005783 Component Endoplasmic reticulum IDA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
GO:0005789 Component Endoplasmic reticulum membrane IDA 16835267, 19240031
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611605 1356 ENSG00000147475
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O94905
Protein name Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (SPFH domain-containing protein 2)
Protein function Component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs) such as ITPR1 (PubMed:17502376, PubMed:19240031). Promotes sterol-accelerated ERAD of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01145 Band_7 24 216 SPFH domain / Band 7 family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10449903}.
Sequence
MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALI
EAEKVAQVAEITYGQKVMEKETEK
KISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD
IPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Sequence length 339
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
19
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of the nervous system Likely pathogenic rs1803175282 RCV001814329
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary spastic paraplegia Likely pathogenic; Pathogenic rs1802811311, rs2129680761, rs2129710278 RCV001391375
RCV001391376
RCV001391377
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary spastic paraplegia 18 Pathogenic; Likely pathogenic rs2487278624, rs2487332031, rs587776893, rs1554517382, rs398123002, rs2129726150, rs779335579, rs2129728774 RCV003327253
RCV004556099
RCV000023901
RCV000499431
RCV000077785
View all (3 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Spastic paraplegia Pathogenic; Likely pathogenic rs1393816662, rs751227210, rs2487294702, rs2487326803, rs2487305222, rs2487289295, rs1554517327, rs1585896928, rs1802811311, rs1052410160, rs1803173923, rs1803294545 RCV001383929
RCV001959693
RCV002791092
RCV002851165
RCV003588496
View all (7 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOSOMAL SPASTIC PARAPLEGIA TYPE 18 Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Likely benign; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGENITAL NEUROLOGIC ANOMALIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ERLIN2-related disorder Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aphasia Aphasia HPO_DG
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma Pubtator 32883232 Associate
★☆☆☆☆
Found in Text Mining only
Autosomal recessive spastic paraplegia type 18 Spastic Paraplegia Orphanet
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 22681620, 22690709, 30016800
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 22681620, 37831636 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 22690709 Stimulate
★☆☆☆☆
Found in Text Mining only
Byzanthine arch palate High palate HPO_DG
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 22681620 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 22690709 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 37575065 Associate
★☆☆☆☆
Found in Text Mining only