ERFE (erythroferrone)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 151176
• Gene name: Erythroferrone
• Gene symbol: ERFE
• Synonyms (NCBI Gene): C1QTNF15, CTRP15, FAM132B
• Chromosome: 2
• Chromosome location: 2q37.3

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0006879	Process	Intracellular iron ion homeostasis	IDA	15514116, 31800957
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	ISS
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	ISS
GO:0015908	Process	Fatty acid transport	IEA
GO:0019217	Process	Regulation of fatty acid metabolic process	IEA
GO:0030509	Process	BMP signaling pathway	IDA	18436533, 31800957
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	31800957
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	ISS
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	ISS
GO:0045721	Process	Negative regulation of gluconeogenesis	IBA
GO:0046326	Process	Positive regulation of D-glucose import	IBA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IBA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0140313	Function	Molecular sequestering activity	IDA	31800957
GO:2000193	Process	Positive regulation of fatty acid transport	IEA

Other IDs

• MIM: 615099
• HGNC: 26727
• e!Ensembl: ENSG00000178752

Protein

• UniProt ID: Q4G0M1
• Protein name: Erythroferrone (Complement C1q tumor necrosis factor-related protein 15) (Myonectin)
• Protein function: Iron-regulatory hormone that acts as an erythroid regulator after hemorrhage: produced by erythroblasts following blood loss and mediates suppression of hepcidin (HAMP) expression in the liver, thereby promoting increased iron absorption and mob
• Sequence:

  MAPARRPAGARLLLVYAGLLAAAAAGLGSPEPGAPSRSRARREPPPGNELPRGPGESRAG
  PAARPPEPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGPPGPPGPQ
  GPPGPIIPPEALLKEFQLLLKGAVRQRERAEPEPCTCGPAGPVAASLAPVSATAGEDDDD
  VVGDVLALLAAPLAPGPRAPRVEAAFLCRLRRDALVERRALHELGVYYLPDAEGAFRRGP
  GLNLTSGQYRAPVAGFYALAATLHVALGEPPRRGPPRPRDHLRLLICIQSRCQRNASLEA
  IMGLESSSELFTISVNGVLYLQMGQWTSVFLDNASGCSLTVRSGSHFSAVLLGV

• Sequence length: 354

Related Genes

No strongly related genes found yet for ERFE.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ERFE.