ERC2-IT1 (ERC2 intronic transcript 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 711 |
| Gene name | ERC2 intronic transcript 1 |
| Gene symbol | ERC2-IT1 |
| Synonyms (NCBI Gene) |
C1orf1C3orf51Po42
|
| Chromosome | 3 |
| Chromosome location | 3p14.3 |
| Summary | This gene is a putative tumor suppressor gene. [provided by RefSeq, Jul 2008] |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
O76042 |
| Protein name | Putative uncharacterized protein encoded by ERC2-IT1 (ERC2 intronic transcript protein 1) (PO42) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Widely expressed. |
| Sequence |
MLACFPCFLRRKMPCLLKVADAGCSVGLGKVHCSCHLPNPRVLRHCDILTGVLTLGLDMS |
| Sequence length | 136 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ERC2-IT1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ERC2-IT1 (see Related Genes above), that are NOT already directly curated for ERC2-IT1 itself -- a lead worth checking, not a confirmed association.
0
|
|