ERAS (ES cell expressed Ras)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3266
• Gene name: ES cell expressed Ras
• Gene symbol: ERAS
• Synonyms (NCBI Gene): HRAS2, HRASP
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cel

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT967789	hsa-miR-1224-3p	CLIP-seq
MIRT967790	hsa-miR-1260	CLIP-seq
MIRT967791	hsa-miR-1260b	CLIP-seq
MIRT967792	hsa-miR-1280	CLIP-seq
MIRT967793	hsa-miR-1827	CLIP-seq
MIRT967794	hsa-miR-3612	CLIP-seq
MIRT967795	hsa-miR-4443	CLIP-seq
MIRT967796	hsa-miR-4802-5p	CLIP-seq
MIRT967797	hsa-miR-483-3p	CLIP-seq
MIRT967798	hsa-miR-532-3p	CLIP-seq
MIRT967799	hsa-miR-650	CLIP-seq

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA

Other IDs

• MIM: 300437
• HGNC: 5174
• e!Ensembl: ENSG00000187682

Protein

• UniProt ID: Q7Z444
• Protein name: GTPase ERas (E-Ras) (EC 3.6.5.2) (Embryonic stem cell-expressed Ras)
• Protein function: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	43 → 201	Ras family	Domain

• Sequence:

  MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQ
  LNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVF
  ALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVET
  SAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA

• Sequence length: 233

Related Genes

No strongly related genes found yet for ERAS.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ERAS.