EPX (eosinophil peroxidase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8288
• Gene name: Eosinophil peroxidase
• Gene symbol: EPX
• Synonyms (NCBI Gene): EPO, EPP, EPX-PEN, EPXD
• Chromosome: 17
• Chromosome location: 17q22
• Summary: This gene is a member of the peroxidase gene family and is expressed in eosinophils. The encoded preproprotein is proteolytically processed into covalently attached heavy and light chains to form the mature enzyme, which functions as an oxidant. The enzym

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434566	G>A	Affects	Coding sequence variant, missense variant
rs141055426	G>A	Affects	Coding sequence variant, missense variant
rs397518446	->G	Affects	Splice acceptor variant, coding sequence variant

miRNA Show/Hide all (156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	19536157
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT639796	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	19536157
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT639796	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT612223	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT612222	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT612221	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT612220	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612219	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT612218	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT612217	hsa-miR-1236-3p	HITS-CLIP	23824327

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002215	Process	Defense response to nematode	IEA
GO:0004601	Function	Peroxidase activity	IBA
GO:0004601	Function	Peroxidase activity	IEA
GO:0004601	Function	Peroxidase activity	TAS	10386597
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0020037	Function	Heme binding	IEA
GO:0032693	Process	Negative regulation of interleukin-10 production	IEA
GO:0032714	Process	Negative regulation of interleukin-5 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072677	Process	Eosinophil migration	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0140825	Function	Lactoperoxidase activity	IEA

Other IDs

• MIM: 131399
• HGNC: 3423
• e!Ensembl: ENSG00000121053

Protein

• UniProt ID: P11678
• Protein name: Eosinophil peroxidase (EPO) (EC 1.11.1.7) [Cleaved into: Eosinophil peroxidase light chain; Eosinophil peroxidase heavy chain]
• Protein function: Mediates tyrosine nitration of secondary granule proteins in mature resting eosinophils. Shows significant inhibitory activity towards Mycobacterium tuberculosis H37Rv by inducing bacterial fragmentation and lysis. {ECO:0000269|PubMed:12540536,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03098	An_peroxidase	145 → 689	Animal haem peroxidase	Domain

• Sequence:

  MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQ
  RLRSGSASPMDLLSYFKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTE
  PQLRLLSQASGCALRDQAERCSDKYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLS
  LPFGWTPSRRRNGFLLPLVRAVSNQIVRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPE
  SPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKNRVRN
  QINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCL
  LTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARK
  IMGAMVQIITYRDFLPLVLGKARARRTLGHYRGYCSNVDPRVANVFTLAFRFGHTMLQPF
  MFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDEL
  RDRLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLAR
  KFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTK
  RQRKALSRISLSRIICDNTGITTVSRDIFRANIYPRGFVNCSRIPRLNLSAWRGT

• Sequence length: 715

Pathways

KEGG Pathway:

Asthma

Reactome Pathway:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Eosinophil peroxidase deficiency	Affects; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (577)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	7736428		★☆☆☆☆ Found in Text Mining only
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	20832699, 31189189		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	17429338		★☆☆☆☆ Found in Text Mining only
Acquired Polyneuropathy	Polyneuropathy	CTD_human_DG	17010629		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10369674, 11843291, 12667989, 1314735, 16598306, 18059484, 19584401, 19665053, 20445019, 2175917, 27465156, 30030607, 3032937, 3498522, 7994027, 8608241, 8861946, 9365246, 9573013		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	21847101, 24561306		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19010836, 21078205		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	16598306, 1728307		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	3801669		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15709164, 30854109		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	27903235		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30854109		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	21829709, 31821092		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15496172		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	15769989, 17045782, 31568062		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	30175513		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29391474		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19439985		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	24814827		★☆☆☆☆ Found in Text Mining only
alpha Thalassemia	Alpha thalassemia	Pubtator	35802781	Inhibit	★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	3101356, 9856674		★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	3101356, 9856674		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22388478	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	18925459, 22388478		★☆☆☆☆ Found in Text Mining only
Amyloidosis, Familial	Amyloidosis	LHGDN	18544472		★☆☆☆☆ Found in Text Mining only
Amyloidosis, Familial	Amyloidosis	BEFREE	18925459, 20979939		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	15496172		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17142042, 17174305, 17439481, 17888545, 24820540, 30175978		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	25595151	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	17888545		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	27549753		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	10326023, 10916088, 11090055, 11414194, 11601763, 12138409, 12203655, 12324918, 12492705, 12753297, 14668002, 15467711, 15496172, 15579525, 15672835, 15856028, 15877674, 16304357, 16407130, 16477581, 16645228, 16648896, 16735711, 16888788, 16909043, 17253966, 17381380, 17453623, 17559739, 17656101, 17845633, 17922127, 18188450, 18204093, 18417212, 18925459, 19077684, 19153070, 1924331, 19536148, 19886790, 20461024, 20463184, 20473273, 2062846, 20631677, 20844235, 20959632, 20979939, 21449784, 21480317, 21798198, 21829709, 21860424, 21863063, 21937702, 22089616, 22264719, 22414872, 22460221, 22596089, 22611156, 22631039, 22644842, 22990115, 23142458, 23286843, 23345622, 23583759, 23619255, 23727690, 23877120, 23881169, 23924660, 24059228, 24120591, 24127691, 24201995, 24747867, 2486284, 25152985, 25182342, 25218788, 25227310, 25392999, 25469044, 25630969, 25650873, 25656761, 25811342, 25915923, 25970251, 26012551, 26412593, 26575329, 26922982, 26976799, 27114509, 27171136, 27737895, 27887750, 27893353, 27903235, 27920250, 27993641, 27999949, 28039503, 28041993, 28066881, 28067195, 28078434, 28099381, 28104107, 28131718, 28142147, 28150286, 28173069, 28174354, 28203295, 28247960, 28248850, 28280364, 28302014, 28302753, 28306566, 28338491, 28383559, 28399115, 28415825, 28417130, 28418910, 28452894, 28452907, 28504901, 28529107, 28600471, 28603097, 28625716, 28629513, 28629521, 28651951, 28662118, 28669019, 28697735, 28706253, 28716301, 28747155, 28766493, 28857467, 28871174, 28928122, 28938907, 28947525, 29066658, 29070774, 29084409, 29128254, 29135370, 29145693, 29147463, 29151105, 29157782, 29178879, 29198116, 29241199, 29282252, 2928334, 29296077, 29345289, 29374477, 29389768, 29415057, 29451472, 29492906, 29502007, 29517550, 29544446, 29545827, 29569190, 29587225, 29592539, 29659573, 29738538, 29746307, 29895954, 29921734, 29923765, 30030607, 30068234, 30075584, 30097240, 30100259, 30136086, 30158520, 30176654, 30209118, 30253403, 30290796, 30294279, 30297879, 3032937, 30348300, 30401705, 30408788, 30412269, 30422000, 30426415, 30446224, 30483799, 30489504, 30544934, 30559105, 30622244, 30625281, 30630985, 30656553, 30680668, 30695814, 30700319, 30703769, 30712038, 30772502, 30776084, 30783118, 30852574, 30915883, 30941747, 30964047, 30973963, 30991401, 30991414, 31005849, 31015255, 31117088, 31161461, 31189174, 31207479, 31230731, 31299495, 31308217, 31340116, 31351867, 31374455, 31387097, 31412807, 31420350, 31423921, 31434707, 31447360, 31453863, 31471363, 31477257, 31483333, 31495895, 31508719, 31533096, 31567284, 31585986, 31596520, 31600973, 31619722, 31628396, 31679114, 31691976, 31770451, 31782127, 31830663, 6095306, 7658325, 7706487, 7742534, 8165050, 8237992, 8390370, 8423222, 8475933, 8486613, 8527225, 9009445, 9081618, 9544165, 9573013, 9631579, 9661799, 9856674, 9886307		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	10506726, 10713657, 11245434, 11273875, 11454181, 11569724, 11828949, 11981781, 12670280, 12713065, 12820454, 12897097, 12899718, 14568602, 14706663, 15160343, 1516988, 15232364, 15660393, 1574960, 16434484, 16511603, 16637862, 16707910, 16798232, 16949463, 16970215, 16970600, 17058596, 17168855, 17180133, 17288690, 17397412, 17409018, 17559739, 18265628, 18403296, 18611800, 18695134, 1893952, 19015056, 19212639, 19787831, 1982298, 20189893, 20303990, 21860424, 2186273, 2206997, 22174104, 23077460, 7529132, 7602351, 7631396, 7732690, 8202718, 8250662, 8260696, 8418619, 8504984, 9118049, 9616293, 9617462, 9743294		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	11090055, 11675943, 15496172, 16304357, 16407130, 20019408, 20473273, 21406725, 25227310, 26922982, 28283061, 29768025, 306845, 31630548, 32027948, 32798645, 37086098, 37123164, 7678508, 9573013	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	11844847, 12846752, 14626572, 15247979, 15798000, 15967106, 16648896, 16888788, 1824252, 18383321, 18596367, 19536148, 19646258, 21098876, 21449784, 22957013, 23337206, 23566571, 24399021, 24502950, 24744598, 25152985, 25915923, 26268514, 26412593, 26700738, 27494133, 28697735, 32842148, 33907089, 35611811, 36183610, 36451454, 38206689, 38254725, 9617872	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	14990112		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	1375845, 33521754	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	8580564	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Dyserythropoietic Congenital	Congenital dyserythropoietic anemia	Pubtator	36927785	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	17107348, 18075299, 22955851, 32912025, 34051741	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	24120591	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	18626921	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	12714517, 24599433	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	1282827, 15755903, 8630424, 9357971		★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	GENOMICS_ENGLAND_DG	28283061		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	CTD_human_DG	10733367, 16629641, 20446436		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	10907638, 21900080, 22094132		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Acquired	Anemia	CTD_human_DG	10733367, 16629641, 20446436		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Congenital	Anemia	BEFREE	11522534		★☆☆☆☆ Found in Text Mining only
Anemia, Microangiopathic	Anemia	CTD_human_DG	10733367, 16629641, 20446436		★☆☆☆☆ Found in Text Mining only
Anemia, Neonatal	Anemia	BEFREE	31340188		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	10331510, 25876995, 28173069, 30695814, 9159314		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21829709		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	30587631		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	39604843	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29208002, 30007232		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1824252	Inhibit	★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	28041993, 28351056		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24802755, 28053519, 28751233, 29400693, 30876376, 30922765		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27434124, 29692868, 30876376, 31300640, 38551536	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	16482103	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29208002, 30007232		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30098034		★☆☆☆☆ Found in Text Mining only
Atrial myxoma familial	Atrial myxoma	Pubtator	23839603	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	15247979	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11950137, 22094132		★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	28960523		★☆☆☆☆ Found in Text Mining only
Autosomal dominant secondary polycythemia	Polycythemia	Orphanet			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24394348, 28273832		★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	31813204		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	10331510, 16304357, 17721544, 28629515		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	CTD_human_DG	16225658		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	16304357, 26376749, 37672319	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	10331510, 16304357, 17721544, 28629515		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30400939		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	3498522		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	30607533		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	27887750		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	11435798, 18841090, 29315561		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	LHGDN	17615151		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	24055514	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	14563949	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20336349, 21749867		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12118093, 16207704, 18084619, 20353997, 21075308, 24165569, 24502950, 28247960, 28260049, 28418910, 29552165, 30700319, 31291309		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12209679, 15160341, 17597020, 18596367, 20164027, 22955851, 24100272, 24165569, 32912025, 34949656	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30160360, 31035257, 31374455		★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	BEFREE	16827884		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12759237, 14965363, 16627979, 22025882, 30915348	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10628941, 11920461, 12239177, 17394495, 19828693, 23830978, 26097591, 26624507, 27774607, 2825172, 28421649, 28739744, 34634301, 36345952, 7524823, 7528138, 9236155	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	17201175	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29345289		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21829709	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10628941, 11986208, 16627979, 16740034, 17696210, 18075299, 19407488, 2162339, 23780896, 27468719, 36966432, 40332447	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26575329	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12759237, 30915348, 39575407	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	21262973, 23936061		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	16449733, 16731534, 17924179, 17928571		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	19958860	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	16449733, 16731534, 17924179, 17928571		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31400858		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15363820		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17896976, 18407263, 21934628, 25169573		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30103295	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	23584809	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	34384366	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	30319361		★☆☆☆☆ Found in Text Mining only
Cellular Ependymoma	Ependymoma	BEFREE	21643803		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	14612494, 28629521		★☆☆☆☆ Found in Text Mining only
Cerebellar hemangioblastoma	Cerebellar hemangioblastoma	BEFREE	1859878		★☆☆☆☆ Found in Text Mining only
Cerebral Hypoxia-Ischemia	Cerebral Hypoxia-Ischemia	BEFREE	29180303, 30970273		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11435798, 28413924, 31679265		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	18715729, 29706928, 30789826, 31708771		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11435798, 15591419, 28987867, 29180303, 29315561, 29697839, 30175978, 30740062, 31024439, 31026988, 31381959		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	16482103	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21442620, 25874769		★☆☆☆☆ Found in Text Mining only
Cervical myelopathy	Cervical myelopathy	BEFREE	31821342		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21442620		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23052842		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	1373333, 16434484	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31423921		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10200985, 10326023, 12620922, 15798000, 17253966, 18204093, 18458324, 18852688, 1992884, 20631677, 21092038, 22721967, 27081865, 27733241, 28104107, 28242135, 28629521, 28697735, 28871174, 28988419, 29084409, 29151105, 29178879, 29545827, 29619552, 29921734, 30412269, 30888086, 31484803, 31485910, 7706487, 8903857		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	10200985, 10326023, 12620922, 15798000, 16138214, 17253966, 17656101, 1992884, 20606417, 20631677, 21863063, 24059228, 25392999, 25745821, 27171136, 27312361, 27733241, 28066881, 28118622, 28142147, 28263291, 28272424, 28302014, 28306566, 28502499, 28540993, 28625716, 28629513, 28629521, 28651951, 28680358, 28766493, 28782299, 28857467, 28928122, 28954928, 28988419, 29044949, 29084409, 29132915, 29137321, 29241199, 29296077, 29374477, 29451472, 29502007, 29545827, 29569190, 29575006, 29659573, 29697839, 29742267, 29746306, 29746307, 30007314, 30008129, 30030607, 30049445, 30084153, 30108502, 30136086, 30176654, 30205954, 30232784, 30253403, 30291472, 30406500, 30426415, 30565999, 30619793, 30625281, 30798815, 30852574, 30915883, 30941190, 30991414, 31117088, 31170159, 31228010, 31387097, 31423921, 31453863, 31526861, 31550724, 31567284, 31583094, 31596520, 31600973, 31619722, 31689455, 31740386, 31770451, 31782127, 31798631, 31839207, 7658325, 8903857		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	16138214		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12187026		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21078205		★☆☆☆☆ Found in Text Mining only
Chronic mountain sickness	Mountain sickness	BEFREE	26272318		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	16810609, 16919893, 17980427, 20727590, 24297870, 29888479, 9414643		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15795697		★☆☆☆☆ Found in Text Mining only
Chuvash erythrocytosis	Chuvash Erythrocytosis	BEFREE	11987242, 16210040, 16210343, 16769575, 21685897, 24729484		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	17640059, 17696210		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	CTD_human_DG	15816862		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	18670620, 28584284		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	8393357		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	20833152		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28718181, 30953276		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21256055, 27579991, 29026145		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23825635, 39891110	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22531693, 27903235, 29160911		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24497137, 29160911, 30538561		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19846965, 22531693, 23825635, 24497137	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	18050204		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	16679645, 17166730		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	21167907, 31821342		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	27081865		★☆☆☆☆ Found in Text Mining only
Congenital Bone Marrow Failure Syndromes	Congenital bone marrow failure syndrome	Pubtator	23713742	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27282568		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CTD_human_DG	27880037		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	27880037		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	19804771		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Bochdalek	Posterolateral diaphragmatic hernia	CTD_human_DG	27880037		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Morgagni	Morgagni diaphragmatic hernia	CTD_human_DG	27880037		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	27880037		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20139114, 20335352, 22777420, 29128254, 30068234, 31423921		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10916088, 11986208, 15709172, 16627979, 17640059, 17696210, 19407488, 21042786, 23305401, 27468719, 28233444		★☆☆☆☆ Found in Text Mining only
Cooley`s anemia	Cooley`s Anemia	CTD_human_DG	16225658		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17998053, 28315563, 28885393, 31707794, 31741439, 31778269		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	25245553		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	25245553		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28315563, 28885393, 29280914, 31707794		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28315563, 28885393, 31707794		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	30834265	Stimulate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	LHGDN	15709172		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30214643		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	2891140, 3462737		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	2891140, 3462737	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	12670338, 17547733		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	27367243, 30220640		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15816862		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15816862		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Deglutition disorder	Pubtator	26051952	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	26051952		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	20818790		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31453787, 31484803		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28488208, 31484803		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	29856157		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27164096, 29673379, 30361931		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15331568, 21149549, 23885016, 24127691, 25169573, 28546424, 28584284, 28850875, 28930549, 29109360, 29203238, 30401898, 30898666, 31423747, 31707794, 31727007		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15331568, 21149549, 23885016, 24127691, 25169573, 28288167, 28407666, 28546424, 28584284, 28850875, 28930549, 29109360, 29203238, 30401898, 30898666, 31423747, 31619722, 31707794, 31727007		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23106921, 33158076	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31316151, 33599115, 35677638	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28546424		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23326455, 25656761, 25675872, 26643367, 31316151, 31727007		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28779372		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34545296	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29203238, 29385703, 31453863		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28299330, 30021390		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	16123502, 18458324		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	16936148, 20065225, 24508793, 25675872, 27190272, 28652140, 29731355, 29896254, 31483932, 31727007, 31799636		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	21067572, 27190272, 31799636, 35677638	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23106921	Stimulate	★☆☆☆☆ Found in Text Mining only
Diamond-Blackfan Anemia 1	Diamond-Blackfan anemia	GENOMICS_ENGLAND_DG	28283061		★☆☆☆☆ Found in Text Mining only
DIAMOND-BLACKFAN ANEMIA-LIKE	Anemia	UNIPROT_DG	28283061		★☆☆☆☆ Found in Text Mining only
DIAMOND-BLACKFAN ANEMIA-LIKE	Anemia	GENOMICS_ENGLAND_DG	28283061		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30973963		★☆☆☆☆ Found in Text Mining only
Disorders of Porphyrin Metabolism	Porphyria	BEFREE	12508966		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	35677638	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	23713742		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	9163594	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28502499, 31740386		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	27434124	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	28277490		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	28454369		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15160341	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15160341		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12525458		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31262977		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	2541222, 31300640	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	28862877, 29228243, 31300640		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	26051952, 29228243		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	39343172	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	14563949		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28236069, 30130550, 31047977		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	26907931		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	27586847		★☆☆☆☆ Found in Text Mining only
Erythema Multiforme	Erythema	BEFREE	28109258		★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	12393546	Stimulate	★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	16210343, 21933857	Associate	★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	10498627, 23716564, 29514032, 30507031, 7306703, 7795221, 7819104, 850518, 9292543, 9649565, 9923445		★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	GENOMICS_ENGLAND_DG	27651169		★☆☆☆☆ Found in Text Mining only
ERYTHROCYTOSIS, FAMILIAL, 5	Erythrocytosis	UNIPROT_DG	27651169, 29514032		★☆☆☆☆ Found in Text Mining only
ERYTHROCYTOSIS, FAMILIAL, 5	Erythrocytosis	GENOMICS_ENGLAND_DG	28283061		★☆☆☆☆ Found in Text Mining only
ERYTHROCYTOSIS, FAMILIAL, 5	Erythrocytosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Erythroid hyperplasia	Erythroid hyperplasia	BEFREE	10582341, 20472853		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	39575407	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	28448184		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	30974232		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	23584701, 29391474		★☆☆☆☆ Found in Text Mining only
Familial erythrocytosis	Erythrocytosis	BEFREE	10364675, 10498627, 23716564, 29514032, 30507031, 7306703, 7819104, 850518, 9292543, 9414643, 9649565, 9923445		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	23713742		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20098278, 26012551, 29522896, 31173165		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	25724399, 30554729		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	18581197, 23859343		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	23859343, 31105516		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	20723003		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	21775095		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 2 (disorder)	Gaucher Disease	BEFREE	21775095		★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	34384366	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	18091448		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17524506, 21749867, 23070117, 24467192, 26178805, 28629521, 30871240, 9787178		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17524506, 21749867, 23070117, 24379112, 24467192, 26178805, 28629521, 30871240		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18754880	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23070117, 24467192, 24841514, 25544764, 31658577		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	29391474		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease XII	Glycogen storage disease	Pubtator	17579185	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	9631579		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	16679645, 17166730		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	27887996, 29077163		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15856028		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	15671524		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	15967106	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	16707910		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	18407263		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	19690392	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	20019408, 20427614, 26721912	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20139114, 22777420, 29128254, 30068234		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	16163267, 16175858, 17218907, 30214643, 9787178		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	15015593	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	15015593		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	1709368	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	1709368	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28280364		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	29285951, 31691976		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	15921401, 27271482		★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	15921401, 27271482		★☆☆☆☆ Found in Text Mining only
Hemoglobin F Disease	Hemoglobinopathy	CTD_human_DG	16225658		★☆☆☆☆ Found in Text Mining only
Hemoglobin H Disease	Hemoglobin H Disease	BEFREE	25477265, 9856674		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	11475152, 19295544, 31792345, 9159314		★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	CTD_human_DG	12053072		★☆☆☆☆ Found in Text Mining only
Hepatic Vein Thrombosis	Hepatic Vein Thrombosis	BEFREE	16827884		★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	25227310	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	14563949	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	14563949, 21788913, 2823941		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	10971213, 11404177, 1915805, 27271482		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11423750, 12324918, 12612986, 28130911, 29168688, 30175513, 31272526, 31412807, 31484803, 31679114		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11423750, 12324918, 12612986, 28130911, 29168688, 30175513, 31272526, 31412807, 31484803, 31679114		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	29982881, 30319361, 30661113		★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	8897559		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	27995496		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	8423222		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29109360, 29174036, 29203238, 30007232, 30597174, 30898666, 31828165		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31740386		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	27586847		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	10792608, 11675943, 21690481, 32027948	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	11675943, 8510379	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	10694834, 1516988		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11675943, 17293480, 17845633, 19458615, 21690481, 21912181, 24729484, 25392999, 28157814, 28340239, 28782299, 29228345, 29633892, 29680240, 29755695, 29843153, 31340116, 8475933		★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	12203655		★☆☆☆☆ Found in Text Mining only
Hypoplastic anemia	Hypoplastic anemia	BEFREE	20407036		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10354503, 11494119, 12393546, 12482504, 12759237, 14563949, 14726398, 15743794, 18050204, 18283323, 19187226, 20164027, 21933857, 22172637, 23509317, 23830978, 24100272, 24497137, 27468719, 28547957, 29534684, 30089456, 31630548, 33256376, 34185793, 37796693, 39370424, 8387202, 9001239, 9236155, 9573013, 9787178	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10358107, 11090055, 11971899, 12070140, 12209679, 12239177, 12761217, 12844285, 1373333, 15160341, 16681756, 19208626, 1985693, 20026900, 21036916, 21406725, 2162339, 23393065, 23852087, 23958427, 2825172, 31417010, 31752873, 7528138, 7980410, 8260699, 8387202, 8917528, 9027728, 9746341	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28535509	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	BEFREE	27887996		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28099423, 28277490, 28456387, 28797191, 29171431, 29478510, 29514165, 29681183, 30514196, 30621649, 30789826, 31084604, 31261373, 31345155		★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	25477265		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21937702		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22669473, 27788929, 28584284, 28718181, 28752903, 29132915, 29673379, 29881418, 29884778, 30400939, 30789826, 30953276, 30974232, 31824247		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22094132		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23197886	Associate	★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	16434484, 29667019, 30501441, 31808893, 9544165		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	12119478, 17488680, 30245128, 30348300, 31105516, 31838956, 8493994		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	26243982	Inhibit	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31838956	Associate	★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	BEFREE	23180434, 28375153		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	15591419, 20547143, 27248662, 27549753, 28817120, 28840056, 30920178, 31211943, 31683519		★☆☆☆☆ Found in Text Mining only
Juvenile hemochromatosis	Hemochromatosis	BEFREE	10942934		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	9167610		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11675943, 17107348, 35422072	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	20606417		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20606417, 22410315, 23881169, 26012551, 27920250, 29203238, 31013255, 31145704, 31740386, 9203047		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	2297568, 26205024	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	15496172, 16138214, 17453623, 19350426, 25915923, 28747155, 7706487		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	CTD_human_DG	22013135		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	11844847, 12846752	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15798000, 24188099, 28697735	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	21847101, 24561306		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	23566289, 27266727, 28383559, 28819767, 29395333, 30132785, 30257316, 30414800, 30712038, 31740386		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	10200985, 10326023, 12612986, 12620922, 15798000, 17253966, 18204093, 18458324, 18852688, 1992884, 20631677, 21092038, 22721967, 27081865, 27733241, 28104107, 28242135, 28629521, 28697735, 28871174, 28988419, 29084409, 29151105, 29157782, 29178879, 29545827, 29619552, 29921734, 30412269, 30888086, 31484803, 31485910, 7658325, 7706487, 8903857		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	16707910		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	18458324		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	4038660		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	10628941, 11986208, 2297568	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	16627979	Stimulate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	33545970, 36397112	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	30909513		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	11328280, 30554729	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Visceral leishmaniasis	Pubtator	9531339	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10582341, 14636647, 16413387, 18055337, 19010836, 19584401, 2657230, 26935061, 28545085, 3498522, 9369430, 9808578		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16413387, 1653276, 1834251, 24761846, 27840303, 3498522, 37543610, 7537740, 8329702, 9657745	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	2460160, 3264194	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	9798667	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10676644, 16598306, 21078205, 9369430		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	9167610		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	LHGDN	18160550		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	25469044, 31161461		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11025195, 11090055, 11408933, 11592940, 12239177, 1653242, 23830978, 24491563, 24841514, 27827952, 2825172, 2849206, 28587437, 28739744, 28743805, 29238266, 30367150, 30723742, 8387202, 8396923, 8626614, 9126339		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26034358	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	19350426		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11025195, 11090055, 12239177, 1653242, 21788913, 23830978, 2825172, 2849206, 28739744, 28743805, 8387202, 8626614		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	17394495	Associate	★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	29694605		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23861852		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27494133	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29951872		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18626921	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29951872		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29570934, 29951872		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29951872		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29951872		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22025882	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	26310513, 28332724		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	26310513, 28332724		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	28332724		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28718181		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	31658577		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15856028		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21142802		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12118093, 16207704, 18084619, 18759245, 20353997, 21075308, 24165569, 24502950, 28247960, 28260049, 28352153, 28418910, 29552165, 30700319, 31291309		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	11986208, 2297568		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29345289		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15467711, 19567780, 29917167, 30958616		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10916088, 11325818, 11950137, 12419827, 12667989, 15467711, 15591419, 15856028, 16207704, 1653276, 17038666, 17253966, 17656101, 18431543, 18620752, 18781955, 19264915, 19536148, 20353997, 20383466, 20384218, 21860424, 22814609, 22843933, 23830978, 23881169, 24059228, 25331796, 26412593, 27145271, 28247960, 28415825, 28504901, 28629522, 28795314, 28985758, 29157782, 29485009, 29719440, 30483799, 30622244, 30854109, 30969847, 30971397, 31322257, 31596520, 31691976, 31704854, 31828489, 31830663, 31846977, 8608241		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	25182342		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21442620		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22531693, 27903235, 29160911		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30501441, 31412807		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18219110		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23861852, 28418910		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	9829852		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15743794		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	15743794		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15743794, 19536148, 20804540	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19536148, 21860424, 28415825		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	31261238		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	8453106		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27164096, 29673379, 30361931		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30400939		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	17922127		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	16740034	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23016887	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25915923	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25915923		★☆☆☆☆ Found in Text Mining only
Microangiopathic hemolytic anemia	Microangiopathic hemolytic anemia	CTD_human_DG	10733367, 16629641, 20446436		★☆☆☆☆ Found in Text Mining only
Microcytic hypochromic anemia (disorder)	Anemia	BEFREE	30630985		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15595630, 18417212, 22596089, 26500139, 28975386, 29895954, 31838956		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	23881169		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29880069, 30400939, 31804779, 31824247		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	29626135		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	15769989		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	15769989		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17107348	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17458859, 18174379, 23881169, 25052873, 26310513, 27581518, 8423222		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16337691, 18670620, 29029628, 29498007, 29856157, 30555484		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	22465474, 29079596, 8695798		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10676644, 1372766, 14636647, 15595630, 15703420, 16735711, 1697782, 18417212, 18829110, 21078205, 22465474, 22596089, 23596104, 24399021, 26500139, 27229713, 27282568, 27870945, 28958287, 28975386, 28983059, 29079596, 29614393, 29720275, 29777631, 29895954, 30287621, 30549002, 30893598, 31005849, 31508719, 31533096, 31650290, 31657156, 31788722, 31838956, 8237992, 8371582, 8374520, 8611449, 8642863, 8695798, 8709617, 9167610		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CTD_human_DG	12670338, 16076383		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	7736428		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10460607, 11122147, 11861273, 15287942, 18383321, 20823131, 21078205, 29079596, 31508719, 31838956, 32027948, 8580564, 9057652	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24399021, 38206689, 8943864	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	16532437, 17077140, 29767854, 31782127		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	3498522, 6939475, 7690436		★☆☆☆☆ Found in Text Mining only
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	BEFREE	6284284		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28126623, 28251679, 2898487, 29888479, 9414643		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	16449733, 16731534, 17924179, 17928571		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11986208, 19690392	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17998053, 20139114, 21362129, 21944383, 22038108, 23453036, 28629520, 28988988, 29120671, 29463714, 29671622		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	19337937		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	17998053, 28885393, 31741439, 31778269		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	19958860	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	16631620		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	12209679	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	29145693, 29895839		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	21262973, 23936061, 29145693, 29767696, 29895839		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11328280, 11414194, 11986208, 12118093, 12393546, 12419827, 12902921, 14563949, 15591419, 15709164, 15709172, 15769989, 16175858, 16307003, 16627979, 17429338, 17610479, 17640059, 17992257, 18084619, 1859878, 18759245, 18781955, 19264915, 19407488, 19536148, 19544471, 19567780, 19886790, 20353997, 21036916, 21042786, 21508364, 2297568, 23052842, 23539726, 23765443, 23877120, 24059228, 24467192, 2486284, 25182342, 25724399, 26481148, 28260049, 28331341, 28415825, 28418910, 28714517, 28871174, 29078273, 29137269, 29345289, 29707043, 30214643, 30554729, 30644531, 31291309, 31452781, 31658577, 7982467, 8332085, 8396923, 8453106		★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	BEFREE	19153070		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	23029019	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	11973422, 20435631, 28676085, 29123527, 30130550, 30175978, 30535439, 31105516		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	9787178		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	10460607, 8695798	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	8580564	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10087335, 12239177, 14563949, 17394500, 17647284, 34556815, 35887076	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10087335, 12239177, 12902921, 15352172, 16407271, 16500719, 17045782, 17647284, 31245372		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	20818790		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22388478, 23029019, 37511274	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15816862		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16407271, 26357589, 28817120, 28987867, 29427085, 29498007, 30021390, 30102955, 30284485, 30341696, 30535439, 30656553, 31199881, 31493483, 31813204		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	17429338		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29856157		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	22089494, 25371017, 30417431		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	25469044, 31161461		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30583863		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	16679645, 17166730		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15709164, 16909043, 27494133, 29132013, 29137269, 29345289, 31752873		★☆☆☆☆ Found in Text Mining only
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	28632028		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	25477265		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23885016, 27690727, 28288167, 29522896, 30772502, 31173165, 31525610		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31525610	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	23016887	Stimulate	★☆☆☆☆ Found in Text Mining only
Obstructive Hydrocephalus	Obstructive Hydrocephalus	BEFREE	29982881		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	28120722, 28527030, 28849680, 29300238, 30647957		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	26205024	Associate	★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	26310513, 30076521		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	25630969, 29039481		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17893874, 17893875		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21829709		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21829709	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	29220591		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	CTD_human_DG	9051142		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	CTD_human_DG	10713657		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21276430		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28373075		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	11530804		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	30287890		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	29207066	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29207066		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	33158076	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30417431		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30417431		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	16679645, 17166730		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	15769989, 17045782, 31568062		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	LHGDN	15769989		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	16936148, 17481772, 18458324, 21092038, 26907931, 31727007, 31802372		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	28629513		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	10200985, 2794053		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	2794053, 30683605		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30292674		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	10628941, 11328280, 11986208, 12393546, 14521712, 16687917, 17579185, 17696210, 18055983, 18378852, 18793248, 1954391, 19735488, 21497288, 21723416, 2297568, 23716564, 24599433, 25452296, 26624507, 26625252, 27614230, 27651169, 27774607, 35304527, 35775283, 7306703, 7524823, 7795221	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	11242597, 11722595, 11987242, 12393546, 12515724, 1316790, 15642677, 15878737, 15921386, 17640059, 17696210, 19295544, 19584401, 20237866, 20587663, 20700488, 22253704, 2297568, 23716564, 23773177, 24297870, 24729484, 25263965, 26706855, 27600268, 28435991, 29118187, 29269524, 2928334, 30502050, 30644531, 30985337, 31091718, 8174675, 8982288, 9058738, 9292543, 9649565		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	21933857	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia primary familial and congenital	Polycythemia, primary familial and congenital	Pubtator	10498627, 12844285, 23716564, 36966432, 7306703, 7795221, 9292543, 9488636, 9649565	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia primary familial and congenital	Polycythemia, primary familial and congenital	Pubtator	1954391	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	10088639, 12756017, 12829587, 12935931, 1316790, 15793561, 16210034, 16684963, 16827884, 16919893, 17198871, 17389763, 17493421, 17713553, 17852451, 17980427, 18616871, 19295544, 19295546, 19735488, 19815050, 20197548, 20425336, 20472853, 20700488, 20727590, 21497288, 21527532, 22144185, 22157736, 22944561, 23382981, 24382738, 25040297, 25116092, 26832847, 30948488, 31525610, 6831048, 7819104, 8174675, 8608241, 8709617, 9121771, 9292543, 9414643		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	12829587, 15102479, 15676208, 17389763, 17852451, 18616871, 19815050, 21497288, 23341442, 23839603, 25040297, 25452296, 30677867, 30948488, 31525610, 31582417, 32296029, 35775283, 36593623, 6831048, 7306707, 8081000, 8608241, 9292543, 9475763	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	23839603, 27614230, 33593422, 39262095	Inhibit	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	LHGDN	14755373		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	CTD_human_DG	17010629		★☆☆☆☆ Found in Text Mining only
Polyneuropathy, Critical Illness	Polyneuropathy	CTD_human_DG	17010629		★☆☆☆☆ Found in Text Mining only
Polyneuropathy, Familial	Polyneuropathy	CTD_human_DG	17010629		★☆☆☆☆ Found in Text Mining only
Polyneuropathy, Motor	Polyneuropathy	CTD_human_DG	17010629		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19010836, 21078205		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31453787, 31484803		★☆☆☆☆ Found in Text Mining only
Presentey Anomaly	Eosinophil peroxidase deficiency	UNIPROT_DG	7809065		★☆☆☆☆ Found in Text Mining only
Presentey Anomaly	Eosinophil peroxidase deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Presentey Anomaly	Eosinophil peroxidase deficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	16532437, 16810609, 16919893, 17077140, 29767854, 31782127		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	16936148, 17481772, 21092038, 28652140, 31802372		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15467711, 19567780, 29917167, 30958616		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15467711		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19567780, 31417010	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29917167		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	27637864		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21258008	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37796693	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	28751233, 8818342		★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	CTD_human_DG	12670338		★☆☆☆☆ Found in Text Mining only
Radiation Syndrome	Radiation Syndrome	BEFREE	29220591		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	20473273, 9167610		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	15877674, 30893598, 8611449, 8709617		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	11986208, 17640059, 17696210, 26575329		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10916088, 15709172, 16175858, 17640059, 17696210, 19407488, 23028796, 23305401, 26575329, 7982467		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16627979		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24350257, 25572934, 26907931, 28535509, 28567417, 29746306, 30565999		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	16138214, 19350426, 21092038, 25915923		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	CTD_human_DG	22013135		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	24317353		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12068288, 16936148, 17389509, 18952918, 25169573, 25675872, 27346390, 30744451, 31243792		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	15215287, 28891332		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	12606578, 18356745, 27346390, 28395368, 29145693, 29731355, 30297879, 30776084		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	40084286	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	34355696	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	26412593	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	26412593		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30941747		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17695539	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22669473, 28718181, 29884778		★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	29155421		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26034358	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29684997		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	8645749		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	29673379		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	17706199		★☆☆☆☆ Found in Text Mining only
Sialuria	Sialuria	BEFREE	17706199		★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	BEFREE	30175513		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	30876376		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	22759774, 28280920, 29217205, 30374309		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	29667019, 8393357		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	15363820		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29217205, 30374309		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	22759774		★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	28587411		★☆☆☆☆ Found in Text Mining only
Spherocytosis Hereditary	Spherocytosis	Pubtator	36927785	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15709164, 25182342		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15967106, 16278379		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15967106, 18802791, 33466212	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15856028, 25182342		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28109258, 29398672, 30799375		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	16679645, 17166730		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29748743		★☆☆☆☆ Found in Text Mining only
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	16679645, 17166730		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29522896, 31173165		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30045276		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22025882	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	26310513, 30076521		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29102603, 30964047, 31191800		★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	CTD_human_DG	18156309		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	16304357	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	CTD_human_DG	16225658		★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	17488680, 30209118, 8952151		★☆☆☆☆ Found in Text Mining only
Thalassemia Minor	Thalassemia	CTD_human_DG	16225658		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	12756017, 14617016, 15034760, 16810609, 16919893, 17719087		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	8580564	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	LHGDN	12171772		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	12515724, 24399021		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	15247979	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	37435906	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	30855492		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	16699298		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	16699298		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	16699298		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	16699298		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid valve disease	Pubtator	21900080	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31749871		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	12148126		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28718181		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	12620922		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	CTD_human_DG	12675867		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11328280, 25724399, 30554729		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23584809	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	CTD_human_DG	25013951		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	15247979	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	CTD_human_DG	18156309		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	CTD_human_DG	19337937		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	37123164	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	14612494, 15709172, 15769989, 16175858, 16627979, 17218907, 17992257		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	14563949	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for EPX.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to EPX.