EPS8L1 (EPS8 signaling adaptor L1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 54869
• Gene name: EPS8 signaling adaptor L1
• Gene symbol: EPS8L1
• Synonyms (NCBI Gene): DRC3, EPS8R1, PP10566
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. At least two alternatively spliced transcript varian

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IDA	14565974
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	14565974
GO:0005515	Function	Protein binding	IPI	14565974, 17617578, 18644376, 21044950, 25825872, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	14565974
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	14565974
GO:0032587	Component	Ruffle membrane	IEA
GO:0032991	Component	Protein-containing complex	IDA	14565974
GO:0035023	Process	Regulation of Rho protein signal transduction	IBA
GO:0035023	Process	Regulation of Rho protein signal transduction	IDA	14565974
GO:0035023	Process	Regulation of Rho protein signal transduction	IEA
GO:0042608	Function	T cell receptor binding	IPI	17617578
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1900029	Process	Positive regulation of ruffle assembly	IBA
GO:1900029	Process	Positive regulation of ruffle assembly	IEA
GO:1900029	Process	Positive regulation of ruffle assembly	IGI	14565974

Other IDs

• MIM: 614987
• HGNC: 21295
• e!Ensembl: ENSG00000131037

Protein

• UniProt ID: Q8TE68
• Protein name: Epidermal growth factor receptor kinase substrate 8-like protein 1 (EPS8-like protein 1) (Epidermal growth factor receptor pathway substrate 8-related protein 1) (EPS8-related protein 1)
• Protein function: Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton.
• PDB: 2K2M , 2ROL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	486 → 529	SH3 domain	Domain
  PF08416	PTB	35 → 165	Phosphotyrosine-binding domain	Domain
  PF18016	SAM_3	625 → 688	SAM domain (Sterile alpha motif)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in placenta. {ECO:0000269|PubMed:14565974}.
• Sequence:

  MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASR
  KLAVMDSQGRVWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRSLL
  LLVCQEPERAQPDVHFFQGLRLGAELIREDIQGALHNYRSGRGERRAAALRATQEELQRD
  RSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPEPVGTSSNADSASP
  DLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRSRRRAAG
  EGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTS
  GGPEFASSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEF
  FSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPESEPQLESETAG
  KWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPGPRL
  HHSQSPARSLNSTPPPPPAPAPAPPPALARPRWDRPRWDSCDSLNGLDPSEKEKFSQMLI
  VNEELQARLAQGRSGPSRAVPGPRAPEPQLSPGSDASEVRAWLQAKGFSSGTVDALGVLT
  GAQLFSLQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEGEVEM
  EVI

• Sequence length: 723

Related Genes

No strongly related genes found yet for EPS8L1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to EPS8L1.