Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	57669
Gene name	Erythrocyte membrane protein band 4.1 like 5
Gene symbol	EPB41L5
Synonyms (NCBI Gene)	BE37LULULULU1YMO1YRT
Chromosome	2
Chromosome location	2q14.2

175 Show/Hide all (175)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022151	hsa-miR-124-3p	Microarray	18668037
MIRT050911	hsa-miR-17-5p	CLASH	23622248
MIRT965818	hsa-miR-1193	CLIP-seq
MIRT965819	hsa-miR-125a-3p	CLIP-seq
MIRT965820	hsa-miR-1275	CLIP-seq
MIRT965821	hsa-miR-129-3p	CLIP-seq
MIRT965822	hsa-miR-3150a-5p	CLIP-seq
MIRT965823	hsa-miR-3150b-5p	CLIP-seq
MIRT965824	hsa-miR-3157-5p	CLIP-seq
MIRT965825	hsa-miR-337-3p	CLIP-seq
MIRT965826	hsa-miR-340	CLIP-seq
MIRT965827	hsa-miR-361-5p	CLIP-seq
MIRT965828	hsa-miR-3622b-5p	CLIP-seq
MIRT965829	hsa-miR-3685	CLIP-seq
MIRT965830	hsa-miR-384	CLIP-seq
MIRT965831	hsa-miR-3908	CLIP-seq
MIRT965832	hsa-miR-3934	CLIP-seq
MIRT965833	hsa-miR-3942-5p	CLIP-seq
MIRT965834	hsa-miR-4307	CLIP-seq
MIRT965835	hsa-miR-4447	CLIP-seq
MIRT965836	hsa-miR-4472	CLIP-seq
MIRT965837	hsa-miR-4506	CLIP-seq
MIRT965838	hsa-miR-4525	CLIP-seq
MIRT965839	hsa-miR-4665-5p	CLIP-seq
MIRT965840	hsa-miR-4687-5p	CLIP-seq
MIRT965841	hsa-miR-4691-3p	CLIP-seq
MIRT965842	hsa-miR-4694-3p	CLIP-seq
MIRT965843	hsa-miR-4703-5p	CLIP-seq
MIRT965844	hsa-miR-4719	CLIP-seq
MIRT965845	hsa-miR-4723-5p	CLIP-seq
MIRT965846	hsa-miR-4753-3p	CLIP-seq
MIRT965847	hsa-miR-4766-3p	CLIP-seq
MIRT965848	hsa-miR-490-3p	CLIP-seq
MIRT965849	hsa-miR-500a	CLIP-seq
MIRT965850	hsa-miR-501-5p	CLIP-seq
MIRT965851	hsa-miR-513b	CLIP-seq
MIRT965852	hsa-miR-541	CLIP-seq
MIRT965853	hsa-miR-555	CLIP-seq
MIRT965854	hsa-miR-625	CLIP-seq
MIRT965855	hsa-miR-654-5p	CLIP-seq
MIRT965856	hsa-miR-764	CLIP-seq
MIRT965857	hsa-miR-9	CLIP-seq
MIRT965858	hsa-miR-105	CLIP-seq
MIRT965818	hsa-miR-1193	CLIP-seq
MIRT965859	hsa-miR-1299	CLIP-seq
MIRT965822	hsa-miR-3150a-5p	CLIP-seq
MIRT965823	hsa-miR-3150b-5p	CLIP-seq
MIRT965860	hsa-miR-3163	CLIP-seq
MIRT965861	hsa-miR-3591-5p	CLIP-seq
MIRT965828	hsa-miR-3622b-5p	CLIP-seq
MIRT965862	hsa-miR-3646	CLIP-seq
MIRT965863	hsa-miR-3920	CLIP-seq
MIRT965864	hsa-miR-4261	CLIP-seq
MIRT965865	hsa-miR-4311	CLIP-seq
MIRT965866	hsa-miR-4324	CLIP-seq
MIRT965867	hsa-miR-4424	CLIP-seq
MIRT965868	hsa-miR-4468	CLIP-seq
MIRT965869	hsa-miR-4501	CLIP-seq
MIRT965870	hsa-miR-4676-5p	CLIP-seq
MIRT965871	hsa-miR-4711-3p	CLIP-seq
MIRT965846	hsa-miR-4753-3p	CLIP-seq
MIRT965872	hsa-miR-548aa	CLIP-seq
MIRT965873	hsa-miR-575	CLIP-seq
MIRT965874	hsa-miR-586	CLIP-seq
MIRT965875	hsa-miR-648	CLIP-seq
MIRT965876	hsa-miR-875-3p	CLIP-seq
MIRT965857	hsa-miR-9	CLIP-seq
MIRT965877	hsa-miR-3140-5p	CLIP-seq
MIRT1986097	hsa-miR-132	CLIP-seq
MIRT1986098	hsa-miR-199a-3p	CLIP-seq
MIRT1986099	hsa-miR-199b-3p	CLIP-seq
MIRT1986100	hsa-miR-212	CLIP-seq
MIRT1986101	hsa-miR-3129-5p	CLIP-seq
MIRT965860	hsa-miR-3163	CLIP-seq
MIRT965862	hsa-miR-3646	CLIP-seq
MIRT965831	hsa-miR-3908	CLIP-seq
MIRT965863	hsa-miR-3920	CLIP-seq
MIRT965833	hsa-miR-3942-5p	CLIP-seq
MIRT1986102	hsa-miR-4282	CLIP-seq
MIRT965834	hsa-miR-4307	CLIP-seq
MIRT1986103	hsa-miR-4423-3p	CLIP-seq
MIRT965843	hsa-miR-4703-5p	CLIP-seq
MIRT965847	hsa-miR-4766-3p	CLIP-seq
MIRT1986104	hsa-miR-4799-5p	CLIP-seq
MIRT1986105	hsa-miR-936	CLIP-seq
MIRT2220629	hsa-miR-1207-5p	CLIP-seq
MIRT2220630	hsa-miR-1226	CLIP-seq
MIRT2220631	hsa-miR-1229	CLIP-seq
MIRT2220632	hsa-miR-130a	CLIP-seq
MIRT2220633	hsa-miR-130b	CLIP-seq
MIRT2220634	hsa-miR-1914	CLIP-seq
MIRT2220635	hsa-miR-19a	CLIP-seq
MIRT2220636	hsa-miR-19b	CLIP-seq
MIRT2220637	hsa-miR-2052	CLIP-seq
MIRT2220638	hsa-miR-2113	CLIP-seq
MIRT2220639	hsa-miR-301a	CLIP-seq
MIRT2220640	hsa-miR-301b	CLIP-seq
MIRT2220641	hsa-miR-3190	CLIP-seq
MIRT2220642	hsa-miR-3665	CLIP-seq
MIRT2220643	hsa-miR-3666	CLIP-seq
MIRT2220644	hsa-miR-3667-5p	CLIP-seq
MIRT2220645	hsa-miR-3670	CLIP-seq
MIRT2220646	hsa-miR-3714	CLIP-seq
MIRT965830	hsa-miR-384	CLIP-seq
MIRT2220647	hsa-miR-3978	CLIP-seq
MIRT2220648	hsa-miR-4260	CLIP-seq
MIRT2220649	hsa-miR-4283	CLIP-seq
MIRT2220650	hsa-miR-4295	CLIP-seq
MIRT2220651	hsa-miR-4300	CLIP-seq
MIRT965834	hsa-miR-4307	CLIP-seq
MIRT2220652	hsa-miR-4489	CLIP-seq
MIRT2220653	hsa-miR-454	CLIP-seq
MIRT2220654	hsa-miR-4671-3p	CLIP-seq
MIRT2220655	hsa-miR-4709-5p	CLIP-seq
MIRT965844	hsa-miR-4719	CLIP-seq
MIRT2220656	hsa-miR-4733-3p	CLIP-seq
MIRT2220657	hsa-miR-4763-3p	CLIP-seq
MIRT2220658	hsa-miR-548an	CLIP-seq
MIRT2220659	hsa-miR-579	CLIP-seq
MIRT2220660	hsa-miR-596	CLIP-seq
MIRT2220661	hsa-miR-657	CLIP-seq
MIRT2220662	hsa-miR-665	CLIP-seq
MIRT2220663	hsa-miR-920	CLIP-seq
MIRT2220664	hsa-miR-922	CLIP-seq
MIRT2220665	hsa-miR-940	CLIP-seq
MIRT2387445	hsa-miR-2115	CLIP-seq
MIRT2387446	hsa-miR-516a-3p	CLIP-seq
MIRT2428597	hsa-miR-3120-3p	CLIP-seq
MIRT2428598	hsa-miR-3672	CLIP-seq
MIRT2428599	hsa-miR-515-5p	CLIP-seq
MIRT2220660	hsa-miR-596	CLIP-seq
MIRT2524392	hsa-let-7a	CLIP-seq
MIRT2524393	hsa-let-7b	CLIP-seq
MIRT2524394	hsa-let-7c	CLIP-seq
MIRT2524395	hsa-let-7d	CLIP-seq
MIRT2524396	hsa-let-7e	CLIP-seq
MIRT2524397	hsa-let-7f	CLIP-seq
MIRT2524398	hsa-let-7g	CLIP-seq
MIRT2524399	hsa-let-7i	CLIP-seq
MIRT2524400	hsa-miR-1182	CLIP-seq
MIRT2524401	hsa-miR-1208	CLIP-seq
MIRT2524402	hsa-miR-1236	CLIP-seq
MIRT2524403	hsa-miR-1266	CLIP-seq
MIRT2524404	hsa-miR-1273d	CLIP-seq
MIRT2524405	hsa-miR-1915	CLIP-seq
MIRT2524406	hsa-miR-202	CLIP-seq
MIRT2524407	hsa-miR-2117	CLIP-seq
MIRT2524408	hsa-miR-3064-3p	CLIP-seq
MIRT2428597	hsa-miR-3120-3p	CLIP-seq
MIRT2524409	hsa-miR-3127-3p	CLIP-seq
MIRT2524410	hsa-miR-3162-3p	CLIP-seq
MIRT2524411	hsa-miR-3173-5p	CLIP-seq
MIRT2524412	hsa-miR-3189-5p	CLIP-seq
MIRT2524413	hsa-miR-365	CLIP-seq
MIRT2524414	hsa-miR-3664-3p	CLIP-seq
MIRT2428598	hsa-miR-3672	CLIP-seq
MIRT2524415	hsa-miR-421	CLIP-seq
MIRT2524416	hsa-miR-4273	CLIP-seq
MIRT2524417	hsa-miR-4286	CLIP-seq
MIRT2524418	hsa-miR-4458	CLIP-seq
MIRT965868	hsa-miR-4468	CLIP-seq
MIRT2524419	hsa-miR-4500	CLIP-seq
MIRT2524420	hsa-miR-4518	CLIP-seq
MIRT2524421	hsa-miR-4690-3p	CLIP-seq
MIRT2220655	hsa-miR-4709-5p	CLIP-seq
MIRT2524422	hsa-miR-4722-3p	CLIP-seq
MIRT2524423	hsa-miR-4758-3p	CLIP-seq
MIRT2428599	hsa-miR-515-5p	CLIP-seq
MIRT2524424	hsa-miR-544b	CLIP-seq
MIRT2220660	hsa-miR-596	CLIP-seq
MIRT2524425	hsa-miR-765	CLIP-seq
MIRT2524426	hsa-miR-939	CLIP-seq
MIRT2524427	hsa-miR-98	CLIP-seq
MIRT2680153	hsa-miR-4280	CLIP-seq
MIRT2680154	hsa-miR-568	CLIP-seq

46 Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001839	Process	Neural plate morphogenesis	IEA
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IEA
GO:0003382	Process	Epithelial cell morphogenesis	IEA
GO:0003383	Process	Apical constriction	IEA
GO:0005515	Function	Protein binding	IPI	17920587
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	IEA
GO:0006931	Process	Substrate-dependent cell migration, cell attachment to substrate	IEA
GO:0007398	Process	Ectoderm development	IEA
GO:0007492	Process	Endoderm development	IEA
GO:0007498	Process	Mesoderm development	IEA
GO:0007509	Process	Mesoderm migration involved in gastrulation	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0009826	Process	Unidimensional cell growth	IEA
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0031032	Process	Actomyosin structure organization	IBA
GO:0031032	Process	Actomyosin structure organization	IEA
GO:0031252	Component	Cell leading edge	IEA
GO:0032525	Process	Somite rostral/caudal axis specification	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0048318	Process	Axial mesoderm development	IEA
GO:0048319	Process	Axial mesoderm morphogenesis	IEA
GO:0048339	Process	Paraxial mesoderm development	IEA
GO:0048617	Process	Embryonic foregut morphogenesis	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070201	Process	Regulation of establishment of protein localization	IEA
GO:0070986	Process	Left/right axis specification	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA

MIM	HGNC	e!Ensembl
611730	19819	ENSG00000115109

Q9HCM4

Protein name

Band 4.1-like protein 5 (Erythrocyte membrane protein band 4.1-like 5)

Protein function

Plays a role in the formation and organization of tight junctions during the establishment of polarity in epithelial cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00373	FERM_M	126 → 235	FERM central domain	Domain
PF08736	FA	337 → 378	FERM adjacent (FA)	Family
PF09379	FERM_N	47 → 109	FERM N-terminal domain	Domain
PF09380	FERM_C	239 → 331	FERM C-terminal PH-like domain	Domain

Sequence

MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPS
ISSAPVPVEIENLPQSPGTDQHDRKCIPLNIDLLNSPDLLEATIGDVIGASDTMETSQAL
NDVNVATRLPGLGEPEVEYETLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLT
EKCLNNVIESPGLNVMRVPPDFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAV
LNENNVPLPKESLETLMLITPADSGSVLKEATDELDALLASLTENLIDHTVAPQVSSTSM
ITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLISPPAPFLVDAVTSSGPILAEE
AVLKQKCLLTTEL

Sequence length

733

Interactions

View interactions

Reactome Pathway
Neurexins and neuroligins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (14)
Acute myeloid leukemia	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (14)
Breast Carcinoma	Breast Carcinoma	BEFREE	30814110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31905344	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31905344	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36596853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28536193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30814110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27871329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30814110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	31467225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	27871329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29502174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27871329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27871329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30814110		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with EPB41L5 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for EPB41L5.

Diseases Linked via Similar Genes Diseases curated for genes most similar to EPB41L5 (see Related Genes above), that are NOT already directly curated for EPB41L5 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to EPB41L5.

EPB41L5 (erythrocyte membrane protein band 4.1 like 5)

Bookmark This Gene