EOLA1 (endothelium and lymphocyte associated ASCH domain 1) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	91966
Gene name	Endothelium and lymphocyte associated ASCH domain 1
Gene symbol	EOLA1
Synonyms (NCBI Gene)	CXorf40CXorf40A
Chromosome	X
Chromosome location	Xq28

4

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15541360
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0010468	Process	Regulation of gene expression	IDA	24916366
GO:0032675	Process	Regulation of interleukin-6 production	IDA	24916366

MIM	HGNC	e!Ensembl
300954	28089	ENSG00000197620

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8TE69
Protein name	Protein EOLA1 (Endothelial-overexpressed lipopolysaccharide-associated factor 1) (Endothelium and lymphocyte associated ASCH domain 1)
Protein function	May play a role in cell protection during the inflammatory response. In epithelial cells, negatively regulates IL6 production and apoptosis through the regulation of MT2A expression (PubMed:24916366).
PDB	5Y7D
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed primarily in heart, skeletal muscle, kidney, liver and placenta. Relatively high level of expression in spleen, colon and small intestine. Almost no expression in brain, thymus, lung and peripheral blood leukocytes. Expressed
Sequence	MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVER LGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKY LTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV
Sequence length	158
Interactions	View interactions