Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51016
Gene name	ER membrane protein complex subunit 9
Gene symbol	EMC9
Synonyms (NCBI Gene)	C14orf122CGI-112FAM158A
Chromosome	14
Chromosome location	14q12

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 22119785, 25416956, 28514442, 32296183, 32439656, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	22119785
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	29242231
GO:0016020	Component	Membrane	IEA
GO:0032977	Function	Membrane insertase activity	IMP	29809151, 30415835
GO:0045050	Process	Protein insertion into ER membrane by stop-transfer membrane-anchor sequence	IDA	29242231
GO:0045050	Process	Protein insertion into ER membrane by stop-transfer membrane-anchor sequence	IMP	29809151, 30415835
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IDA	29242231
GO:0072546	Component	EMC complex	IBA
GO:0072546	Component	EMC complex	IDA	22119785
GO:0072546	Component	EMC complex	IEA
GO:0072546	Component	EMC complex	ISS

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9Y3B6

Protein name

ER membrane protein complex subunit 9 (Protein FAM158A)

Protein function

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed:29242231, PubMed:29809151, PubMed:30415835, PubMed

PDB

6Y4L , 6Z3W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03665	UPF0172	3 → 191	Uncharacterised protein family (UPF0172)	Family

Sequence

MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVML
EVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQK
LVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLD
DIRQDWTNQRLNTQITQWVGPTNGNGNA

Sequence length

208

Interactions

View interactions

Related Genes Genes most often co-reported with EMC9 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for EMC9.

Diseases Linked via Similar Genes Diseases curated for genes most similar to EMC9 (see Related Genes above), that are NOT already directly curated for EMC9 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to EMC9.

EMC9 (ER membrane protein complex subunit 9)

Bookmark This Gene