EMC6 (ER membrane protein complex subunit 6)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 83460
• Gene name: ER membrane protein complex subunit 6
• Gene symbol: EMC6
• Synonyms (NCBI Gene): RAB5IFL, TMEM93
• Chromosome: 17
• Chromosome location: 17p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028803	hsa-miR-26b-5p	Microarray	19088304
MIRT031392	hsa-miR-16-5p	Proteomics	18668040
MIRT032218	hsa-let-7b-5p	Proteomics	18668040
MIRT042337	hsa-miR-484	CLASH	23622248
MIRT041311	hsa-miR-193b-3p	CLASH	23622248

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IMP	23182941
GO:0005515	Function	Protein binding	IPI	22119785, 23182941, 32296183, 32439656, 33961781
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	23182941, 32439656
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	29242231
GO:0016020	Component	Membrane	IDA	22119785
GO:0016020	Component	Membrane	IEA
GO:0032977	Function	Membrane insertase activity	IMP	29809151, 30415835, 34918864
GO:0045050	Process	Protein insertion into ER membrane by stop-transfer membrane-anchor sequence	IDA	29242231
GO:0045050	Process	Protein insertion into ER membrane by stop-transfer membrane-anchor sequence	IMP	29809151, 30415835
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IDA	29242231
GO:0071816	Process	Tail-anchored membrane protein insertion into ER membrane	IMP	29242231, 34918864
GO:0072546	Component	EMC complex	IBA
GO:0072546	Component	EMC complex	IDA	22119785
GO:0072546	Component	EMC complex	IEA
GO:0072546	Component	EMC complex	IPI	32439656
GO:0072546	Component	EMC complex	ISS
GO:1903349	Component	Omegasome membrane	IDA	23182941

Other IDs

• MIM: 620261
• HGNC: 28430
• e!Ensembl: ENSG00000127774

Protein

• UniProt ID: Q9BV81
• Protein name: ER membrane protein complex subunit 6 (Transmembrane protein 93)
• Protein function: Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed:29242231, PubMed:29809151, PubMed:30415835, PubMed
• PDB: 6WW7 , 6Z3W , 7ADO , 7ADP , 8EOI , 8J0N , 8J0O , 8S9S , 9C7V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07019	Rab5ip	25 → 104	Rab5-interacting protein (Rab5ip)	Family

• Sequence:

  MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV
  LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

• Sequence length: 110

Related Genes

No strongly related genes found yet for EMC6.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to EMC6.