ELF5 (E74 like ETS transcription factor 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2001
• Gene name: E74 like ETS transcription factor 5
• Gene symbol: ELF5
• Synonyms (NCBI Gene): ESE2
• Chromosome: 11
• Chromosome location: 11p13
• Summary: The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of

miRNA Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006662	hsa-miR-5787	Luciferase reporter assay, qRT-PCR, Western blot	22062548
MIRT006662	hsa-miR-5787	Luciferase reporter assay, qRT-PCR, Western blot	22062548
MIRT720645	hsa-miR-548av-3p	HITS-CLIP	19536157
MIRT720644	hsa-miR-217	HITS-CLIP	19536157
MIRT720643	hsa-miR-6807-3p	HITS-CLIP	19536157
MIRT720642	hsa-miR-4317	HITS-CLIP	19536157
MIRT720641	hsa-miR-1256	HITS-CLIP	19536157
MIRT720640	hsa-miR-520a-5p	HITS-CLIP	19536157
MIRT720639	hsa-miR-525-5p	HITS-CLIP	19536157
MIRT720638	hsa-miR-192-3p	HITS-CLIP	19536157
MIRT720637	hsa-miR-3180-5p	HITS-CLIP	19536157
MIRT720636	hsa-miR-519c-3p	HITS-CLIP	19536157
MIRT720645	hsa-miR-548av-3p	HITS-CLIP	19536157
MIRT720644	hsa-miR-217	HITS-CLIP	19536157
MIRT720643	hsa-miR-6807-3p	HITS-CLIP	19536157
MIRT720642	hsa-miR-4317	HITS-CLIP	19536157
MIRT720641	hsa-miR-1256	HITS-CLIP	19536157
MIRT720640	hsa-miR-520a-5p	HITS-CLIP	19536157
MIRT720639	hsa-miR-525-5p	HITS-CLIP	19536157
MIRT720638	hsa-miR-192-3p	HITS-CLIP	19536157
MIRT720637	hsa-miR-3180-5p	HITS-CLIP	19536157
MIRT720636	hsa-miR-519c-3p	HITS-CLIP	19536157
MIRT960173	hsa-miR-1208	CLIP-seq
MIRT960174	hsa-miR-1257	CLIP-seq
MIRT960175	hsa-miR-1285	CLIP-seq
MIRT960176	hsa-miR-3187-5p	CLIP-seq
MIRT960177	hsa-miR-3614-5p	CLIP-seq
MIRT960178	hsa-miR-3689a-3p	CLIP-seq
MIRT960179	hsa-miR-3689c	CLIP-seq
MIRT960180	hsa-miR-4292	CLIP-seq
MIRT960181	hsa-miR-4420	CLIP-seq
MIRT960182	hsa-miR-4452	CLIP-seq
MIRT960183	hsa-miR-4728-5p	CLIP-seq
MIRT960184	hsa-miR-612	CLIP-seq
MIRT960185	hsa-miR-668	CLIP-seq
MIRT960177	hsa-miR-3614-5p	CLIP-seq
MIRT960178	hsa-miR-3689a-3p	CLIP-seq
MIRT960179	hsa-miR-3689c	CLIP-seq
MIRT960183	hsa-miR-4728-5p	CLIP-seq
MIRT2219514	hsa-miR-101	CLIP-seq
MIRT960175	hsa-miR-1285	CLIP-seq
MIRT2219515	hsa-miR-1913	CLIP-seq
MIRT2219516	hsa-miR-24	CLIP-seq
MIRT2219517	hsa-miR-3122	CLIP-seq
MIRT960176	hsa-miR-3187-5p	CLIP-seq
MIRT2219518	hsa-miR-324-3p	CLIP-seq
MIRT960177	hsa-miR-3614-5p	CLIP-seq
MIRT960178	hsa-miR-3689a-3p	CLIP-seq
MIRT960179	hsa-miR-3689c	CLIP-seq
MIRT2219519	hsa-miR-3913-5p	CLIP-seq
MIRT2219520	hsa-miR-3929	CLIP-seq
MIRT2219521	hsa-miR-4284	CLIP-seq
MIRT960180	hsa-miR-4292	CLIP-seq
MIRT2219522	hsa-miR-4419b	CLIP-seq
MIRT2219523	hsa-miR-4478	CLIP-seq
MIRT2219524	hsa-miR-4726-3p	CLIP-seq
MIRT960183	hsa-miR-4728-5p	CLIP-seq
MIRT2219525	hsa-miR-485-5p	CLIP-seq
MIRT960184	hsa-miR-612	CLIP-seq
MIRT2219526	hsa-miR-764	CLIP-seq
MIRT2522760	hsa-miR-146a	CLIP-seq
MIRT2522761	hsa-miR-146b-5p	CLIP-seq
MIRT2522762	hsa-miR-3163	CLIP-seq
MIRT2522763	hsa-miR-3613-3p	CLIP-seq
MIRT2522764	hsa-miR-3662	CLIP-seq
MIRT2522765	hsa-miR-371-5p	CLIP-seq
MIRT2522766	hsa-miR-371b-5p	CLIP-seq
MIRT2522767	hsa-miR-589	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001712	Process	Ectodermal cell fate commitment	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007398	Process	Ectoderm development	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060806	Process	Negative regulation of cell differentiation involved in embryonic placenta development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 605169
• HGNC: 3320
• e!Ensembl: ENSG00000135374

Protein

• UniProt ID: Q9UKW6
• Protein name: ETS-related transcription factor Elf-5 (E74-like factor 5) (Epithelium-restricted ESE-1-related Ets factor) (Epithelium-specific Ets transcription factor 2) (ESE-2)
• Protein function: Transcriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation. ; Isoform 2 binds to DNA sequences containing the consensus nucleotide core sequen
• PDB: 1WWX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00178	Ets	174 → 254	Ets-domain	Domain
  PF02198	SAM_PNT	45 → 129	Sterile alpha motif (SAM)/Pointed domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, kidney and prostate. Weakly expressed in placenta and lung. Isoform 1 and isoform 2 are differentially express
• Sequence:

  MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVH
  PEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYF
  ILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVR
  DLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTG
  ILERVDRRLVYKFGKNAHGWQEDKL

• Sequence length: 265

Pathways

KEGG Pathway:

Prolactin signaling pathway

Related Genes

No strongly related genes found yet for ELF5.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ELF5.