Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	1978
Gene name	Eukaryotic translation initiation factor 4E binding protein 1
Gene symbol	EIF4EBP1
Synonyms (NCBI Gene)	4E-BP14EBP1BP-1PHAS-I
Chromosome	8
Chromosome location	8p11.23
Summary	This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subu

213

Show/Hide all (213)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000347	hsa-miR-125b-5p	MicroarrayqRT-PCR	17891175
MIRT021307	hsa-miR-125a-5p	Sequencing	20371350
MIRT022876	hsa-miR-124-3p	Microarray	18668037
MIRT000347	hsa-miR-125b-5p	ImmunoblotImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCR	22071331
MIRT682577	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682576	hsa-miR-25-3p	HITS-CLIP	23706177
MIRT682575	hsa-miR-32-5p	HITS-CLIP	23706177
MIRT682574	hsa-miR-363-3p	HITS-CLIP	23706177
MIRT682573	hsa-miR-367-3p	HITS-CLIP	23706177
MIRT682572	hsa-miR-92a-3p	HITS-CLIP	23706177
MIRT682571	hsa-miR-92b-3p	HITS-CLIP	23706177
MIRT682570	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682569	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT682568	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682567	hsa-miR-661	HITS-CLIP	23706177
MIRT682566	hsa-miR-4640-5p	HITS-CLIP	23706177
MIRT682565	hsa-miR-4726-5p	HITS-CLIP	23706177
MIRT682564	hsa-miR-6508-3p	HITS-CLIP	23706177
MIRT682563	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682562	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682561	hsa-miR-7703	HITS-CLIP	23706177
MIRT682560	hsa-miR-4325	HITS-CLIP	23706177
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT624047	hsa-miR-5186	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT624047	hsa-miR-5186	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT624047	hsa-miR-5186	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT363750	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT363764	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT363762	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT567683	hsa-miR-5094	PAR-CLIP	20371350
MIRT363759	hsa-miR-4686	PAR-CLIP	20371350
MIRT363756	hsa-miR-4457	PAR-CLIP	20371350
MIRT567682	hsa-miR-5693	PAR-CLIP	20371350
MIRT567681	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT363767	hsa-miR-93-3p	PAR-CLIP	20371350
MIRT363753	hsa-miR-3692-5p	PAR-CLIP	20371350
MIRT363747	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT567680	hsa-miR-7112-3p	PAR-CLIP	20371350
MIRT567679	hsa-miR-4711-5p	PAR-CLIP	20371350
MIRT363752	hsa-miR-3612	PAR-CLIP	20371350
MIRT363748	hsa-miR-650	PAR-CLIP	20371350
MIRT363765	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT363763	hsa-miR-6071	PAR-CLIP	20371350
MIRT363754	hsa-miR-4443	PAR-CLIP	20371350
MIRT477545	hsa-miR-6165	PAR-CLIP	23592263
MIRT477544	hsa-miR-4459	PAR-CLIP	23592263
MIRT477543	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT477542	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT477541	hsa-miR-1273e	PAR-CLIP	23592263
MIRT363746	hsa-miR-138-5p	Luciferase reporter assay	26891291
MIRT363746	hsa-miR-138-5p	Luciferase reporter assayqRT-PCR	28075468
MIRT363746	hsa-miR-138-5p	Luciferase reporter assayqRT-PCR	28075468
MIRT021307	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	26646586
MIRT021307	hsa-miR-125a-5p	Luciferase reporter assayqRT-PCRWestern blot	26646586
MIRT000347	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	26646586
MIRT000347	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	26646586
MIRT682577	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682576	hsa-miR-25-3p	HITS-CLIP	23706177
MIRT682575	hsa-miR-32-5p	HITS-CLIP	23706177
MIRT682574	hsa-miR-363-3p	HITS-CLIP	23706177
MIRT682573	hsa-miR-367-3p	HITS-CLIP	23706177
MIRT682572	hsa-miR-92a-3p	HITS-CLIP	23706177
MIRT682571	hsa-miR-92b-3p	HITS-CLIP	23706177
MIRT682570	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682569	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT682568	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682567	hsa-miR-661	HITS-CLIP	23706177
MIRT682566	hsa-miR-4640-5p	HITS-CLIP	23706177
MIRT682565	hsa-miR-4726-5p	HITS-CLIP	23706177
MIRT682564	hsa-miR-6508-3p	HITS-CLIP	23706177
MIRT682563	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682562	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682561	hsa-miR-7703	HITS-CLIP	23706177
MIRT682560	hsa-miR-4325	HITS-CLIP	23706177
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT624047	hsa-miR-5186	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT624047	hsa-miR-5186	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT624047	hsa-miR-5186	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615742	hsa-miR-4677-3p	HITS-CLIP	23824327
MIRT615741	hsa-miR-4679	HITS-CLIP	23824327
MIRT615740	hsa-miR-5702	HITS-CLIP	23824327
MIRT615739	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT615738	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT615737	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT363750	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT363764	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT363762	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT567683	hsa-miR-5094	PAR-CLIP	20371350
MIRT363759	hsa-miR-4686	PAR-CLIP	20371350
MIRT363756	hsa-miR-4457	PAR-CLIP	20371350
MIRT567682	hsa-miR-5693	PAR-CLIP	20371350
MIRT567681	hsa-miR-194-3p	PAR-CLIP	20371350
MIRT363767	hsa-miR-93-3p	PAR-CLIP	20371350
MIRT363753	hsa-miR-3692-5p	PAR-CLIP	20371350
MIRT363747	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT567680	hsa-miR-7112-3p	PAR-CLIP	20371350
MIRT567679	hsa-miR-4711-5p	PAR-CLIP	20371350
MIRT363752	hsa-miR-3612	PAR-CLIP	20371350
MIRT363748	hsa-miR-650	PAR-CLIP	20371350
MIRT363765	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT363763	hsa-miR-6071	PAR-CLIP	20371350
MIRT363754	hsa-miR-4443	PAR-CLIP	20371350
MIRT477545	hsa-miR-6165	PAR-CLIP	23592263
MIRT477544	hsa-miR-4459	PAR-CLIP	23592263
MIRT477543	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT477542	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT477541	hsa-miR-1273e	PAR-CLIP	23592263
MIRT958333	hsa-miR-1207-5p	CLIP-seq
MIRT958334	hsa-miR-1252	CLIP-seq
MIRT958335	hsa-miR-1291	CLIP-seq
MIRT958336	hsa-miR-1298	CLIP-seq
MIRT958337	hsa-miR-1343	CLIP-seq
MIRT958338	hsa-miR-1909	CLIP-seq
MIRT958339	hsa-miR-1976	CLIP-seq
MIRT958340	hsa-miR-202	CLIP-seq
MIRT958341	hsa-miR-3127-3p	CLIP-seq
MIRT958342	hsa-miR-3170	CLIP-seq
MIRT958343	hsa-miR-3189-3p	CLIP-seq
MIRT958344	hsa-miR-3202	CLIP-seq
MIRT958345	hsa-miR-328	CLIP-seq
MIRT958346	hsa-miR-342-5p	CLIP-seq
MIRT958347	hsa-miR-3655	CLIP-seq
MIRT958348	hsa-miR-4436b-5p	CLIP-seq
MIRT958349	hsa-miR-4476	CLIP-seq
MIRT958350	hsa-miR-4533	CLIP-seq
MIRT958351	hsa-miR-4651	CLIP-seq
MIRT958352	hsa-miR-4660	CLIP-seq
MIRT958353	hsa-miR-4664-5p	CLIP-seq
MIRT958354	hsa-miR-4736	CLIP-seq
MIRT958355	hsa-miR-4763-3p	CLIP-seq
MIRT958356	hsa-miR-483-3p	CLIP-seq
MIRT958357	hsa-miR-578	CLIP-seq
MIRT958358	hsa-miR-608	CLIP-seq
MIRT958359	hsa-miR-668	CLIP-seq
MIRT958360	hsa-miR-885-3p	CLIP-seq
MIRT1548270	hsa-miR-138	CLIP-seq
MIRT1548271	hsa-miR-4694-5p	CLIP-seq
MIRT1548272	hsa-miR-4779	CLIP-seq
MIRT958336	hsa-miR-1298	CLIP-seq
MIRT1556274	hsa-miR-3652	CLIP-seq
MIRT1556275	hsa-miR-4430	CLIP-seq
MIRT1556276	hsa-miR-4492	CLIP-seq
MIRT1556277	hsa-miR-4498	CLIP-seq
MIRT1556278	hsa-miR-762	CLIP-seq
MIRT2219132	hsa-miR-1238	CLIP-seq
MIRT1548270	hsa-miR-138	CLIP-seq
MIRT2219133	hsa-miR-2110	CLIP-seq
MIRT2219134	hsa-miR-3150a-3p	CLIP-seq
MIRT2219135	hsa-miR-3183	CLIP-seq
MIRT958346	hsa-miR-342-5p	CLIP-seq
MIRT2219136	hsa-miR-3665	CLIP-seq
MIRT2219137	hsa-miR-4271	CLIP-seq
MIRT2219138	hsa-miR-4419a	CLIP-seq
MIRT2219139	hsa-miR-4510	CLIP-seq
MIRT958350	hsa-miR-4533	CLIP-seq
MIRT958351	hsa-miR-4651	CLIP-seq
MIRT958353	hsa-miR-4664-5p	CLIP-seq
MIRT1548271	hsa-miR-4694-5p	CLIP-seq
MIRT2219140	hsa-miR-4716-3p	CLIP-seq
MIRT2219141	hsa-miR-4723-3p	CLIP-seq
MIRT2219142	hsa-miR-4723-5p	CLIP-seq
MIRT2219143	hsa-miR-4725-3p	CLIP-seq
MIRT2219144	hsa-miR-4728-5p	CLIP-seq
MIRT958354	hsa-miR-4736	CLIP-seq
MIRT2219145	hsa-miR-4747-5p	CLIP-seq
MIRT1548272	hsa-miR-4779	CLIP-seq
MIRT2219146	hsa-miR-486-3p	CLIP-seq
MIRT958358	hsa-miR-608	CLIP-seq
MIRT2219147	hsa-miR-635	CLIP-seq
MIRT2219148	hsa-miR-764	CLIP-seq
MIRT958339	hsa-miR-1976	CLIP-seq
MIRT958340	hsa-miR-202	CLIP-seq
MIRT958352	hsa-miR-4660	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IMP	14673156
GO:0005515	Function	Protein binding	IPI	7651417, 10772338, 12150925, 12150926, 15094042, 15153109, 16189514, 16271312, 16504179, 17368478, 18337751, 18955708, 19834456, 20224576, 20671708, 20880835, 21191102, 22678294, 24211447, 24722188, 24981860, 25416956, 28514442, 28698298, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23814182
GO:0005829	Component	Cytosol	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0008190	Function	Eukaryotic initiation factor 4E binding	IBA
GO:0008190	Function	Eukaryotic initiation factor 4E binding	IDA	23814182
GO:0008190	Function	Eukaryotic initiation factor 4E binding	IEA
GO:0008190	Function	Eukaryotic initiation factor 4E binding	IPI	38177902
GO:0017148	Process	Negative regulation of translation	IDA	9453748
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030371	Function	Translation repressor activity	IBA
GO:0030371	Function	Translation repressor activity	IDA	22578813
GO:0031369	Function	Translation initiation factor binding	EXP	9453748
GO:0031369	Function	Translation initiation factor binding	IPI	17368478
GO:0031929	Process	TOR signaling	IDA	12150926, 22578813
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	14673156
GO:0045947	Process	Negative regulation of translational initiation	IBA
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045947	Process	Negative regulation of translational initiation	IEA

MIM	HGNC	e!Ensembl
602223	3288	ENSG00000187840

Q13541

Protein name

Eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) (eIF4E-binding protein 1) (Phosphorylated heat- and acid-stable protein regulated by insulin 1) (PHAS-I)

Protein function

Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hy

PDB

1EJ4 , 1EJH , 1WKW , 2JGB , 2JGC , 2V8W , 2V8X , 2V8Y , 3HXG , 3HXI , 3M93 , 3M94 , 3U7X , 4UED , 5BXV , 5EKV , 5NVN , 5WBJ , 6BCU , 6BCX , 8RCH , 8RCK , 8RCN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05456	eIF_4EBP	1 → 118	Eukaryotic translation initiation factor 4E binding protein (EIF4EBP)	Family

Sequence

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Sequence length

118

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (200)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	19458359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	19458359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	18280804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23728071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20621385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20663899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	24891456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29103956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	24891456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19271249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	22977662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25673820, 28279716, 31672935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24021960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24021960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	24891456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34963488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31028998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	17015815		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21366462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11572994, 15762851, 17230047, 28360522, 28628769, 8917544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar I disorder	Bipolar Disorder	BEFREE	24522887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22110663, 23682785, 28427860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15193258, 15501954, 21748818, 21750861, 24131622, 25620657, 26151180, 26698305, 26936396, 28886403, 30244971, 30360374, 31122207, 31182914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15193258, 16648488, 24131622, 26698305, 26936396, 27280636, 31122207, 32649310, 33911160, 35441810, 36135836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	27280636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25658620, 25755728, 26163618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18181165, 25466966, 25912437, 26901143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23383345, 24466059, 25658620, 27779207, 33783376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	20817788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22110663, 23682785, 28427860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23640516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20304964, 21881486, 22542128, 25186283, 26224474, 27026382, 27387559, 30297141, 31626592, 38537932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	20817788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26097581, 34517553, 35737644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26646586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29103956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	19401700, 20164240, 30216418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25999352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28578881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30678221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28242042, 28339030, 28592131, 30201826, 31057298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22828149, 23624914, 25755728, 26204490, 31057298, 32000660, 36030982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	19533653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	18181165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31650481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21813464, 27026382, 27840968, 29942157, 30297141, 31463638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	BEFREE	23456819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17230047, 28628769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	28711648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30537078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20547975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20547975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26269521	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28017449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23636313, 29361117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	28241886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolism, Tumor	Embolism	BEFREE	25658620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24131622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16580307, 29182407, 30979588, 31192127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19107520, 29182407, 31892849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19429661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	22071331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30672889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	31646342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25439783, 25912437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25439783, 25912437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25439783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26722465, 32908901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	33243243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	28879901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	28711648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19251093, 27440383, 28696243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27440383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19251093, 27440383, 28696243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19671762, 22753230, 27065332, 35287169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21898433, 30894372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26832959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31650481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	22648906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	37108648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	26516161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24131622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	29103956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	2004437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIb	Hyperlipoproteinemia	BEFREE	2004437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	30794603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	15901615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16648488, 21881486, 26193287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10811643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	30690033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23708663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	21813464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	21813464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27226530	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	23573198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30017192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15550488, 19458359, 21067588, 21415215, 24404189, 35579750, 39300580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	19458359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21067588, 21628411, 24404189, 25598437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	30654529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18181165, 18675992, 25656579, 25658620, 26026051, 27779207, 28881582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28095607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11120763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28095607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11120763, 28095607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28095607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27026382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15010827, 21366462, 24648290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24586420, 35184749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	21366462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16912221, 21366462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Lymphocytic, Intermediate	Lymphoma, Lymphocytic, Intermediate	CTD_human_DG	17148679		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	15762851		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	15762851		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	15762851		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	15762851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17230047, 28241886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21898433, 30894372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	CTD_human_DG	17148679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15501954, 17996713, 21748818, 21750861, 24131622, 25620657, 26151180, 26698305, 26936396, 28886403, 30244971, 30360374, 31122207, 31182914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29182407, 30979588, 31192127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25439783, 25912437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	21813464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23640516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26646586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23734772, 31672935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17440067, 17891175, 19383915, 20026909, 22546217, 26577921, 29453322, 30476726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26520441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22110663, 23682785, 28427860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21366462, 22110663, 24970798, 26829052, 28238967, 28696243, 29263324, 29416809, 29453322, 29712774, 30257881, 30661989, 31122207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25961827, 30678221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	27827806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16648488, 17200342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31122207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	10743849, 17064428, 30274650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17148679, 22879389, 23963361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29103956		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19336517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19336517, 25749517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17230047, 28628769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Dermatofibrosarcoma Protuberans	Metastatic Dermatofibrosarcoma Protuberans	BEFREE	28711648		★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	27026382, 30061365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26787461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	26995248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22045983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20616057, 21993902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30223933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	21685545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22071331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20338061, 28075468, 29344638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20338061, 25100829, 25165983, 26942880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17148679, 18219697, 18708753, 19251093, 19336517, 19429661, 19648884, 20338061, 20609351, 21321202, 21890461, 22020193, 23542178, 23563181, 23728071 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29266342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16618749, 26360779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	15501954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17273556, 28544394, 30113718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27245338	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	24597478	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26646586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16983702, 26646586, 30712414, 31477750, 36849137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23734772, 31672935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25673820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29233971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24583924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23082216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	31646342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	24404189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	24404189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	29361117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	30624667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17440067, 17891175, 19383915, 20026909, 22546217, 26577921, 29453322, 30476726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16652388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19773438, 26011939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26577921, 31885728, 35257419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21813464, 27026382, 27840968, 30297141, 31463638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31154001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29198077, 31028998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	30282812, 33191406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	23861137	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	12802785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27749759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29290965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23728071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17360108, 25439783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18538015, 20513033, 26832959, 31756179, 35768785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21898433, 31756179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19360336, 25286393, 26520441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25286393, 26520441, 27156070, 36181978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	30690033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37794467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17353907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	26163618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30050079, 31707383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33911160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	12867426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	21813464		★★★★★ ★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	21813464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28241886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20939013, 22110663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	22110663, 23107319		★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF4EBP1 (eukaryotic translation initiation factor 4E binding protein 1)