Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	255308
Gene name	Eukaryotic translation initiation factor 2 subunit gamma B
Gene symbol	EIF2S3B
Synonyms (NCBI Gene)	EIF2S3LeIF-2gAeIF2gA
Chromosome	12
Chromosome location	12p13.2

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence
GO:0000049	Function	TRNA binding	IBA
GO:0000049	Function	TRNA binding	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001731	Process	Formation of translation preinitiation complex	IBA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IBA
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IEA
GO:0016787	Function	Hydrolase activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q2VIR3

Protein name

Eukaryotic translation initiation factor 2 subunit 3B (EC 3.6.5.3) (Eukaryotic translation initiation factor 2 subunit gamma A) (eIF-2-gamma A) (eIF-2gA)

Protein function

Member of the eIF2 complex that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form the 43S pre-initiation co

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00009	GTP_EFTU	39 → 245	Elongation factor Tu GTP binding domain	Domain
PF03144	GTP_EFTU_D2	276 → 359	Elongation factor Tu domain 2	Domain
PF09173	eIF2_C	369 → 459	Initiation factor eIF2 gamma, C terminal	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in testis at the mRNA level. {ECO:0000269|PubMed:9736774}.

Sequence

MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGT
KGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQETEVRPGI
VSKDSEGKLMCKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQILGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Sequence length

472

Interactions

View interactions

Related Genes Genes most often co-reported with EIF2S3B across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for EIF2S3B.

Diseases Linked via Similar Genes Diseases curated for genes most similar to EIF2S3B (see Related Genes above), that are NOT already directly curated for EIF2S3B itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to EIF2S3B.

EIF2S3B (eukaryotic translation initiation factor 2 subunit gamma B)

Save This Analysis