Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	8894
Gene name	Eukaryotic translation initiation factor 2 subunit beta
Gene symbol	EIF2S2
Synonyms (NCBI Gene)	EIF2EIF2BEIF2betaPPP1R67eIF-2-beta
Chromosome	20
Chromosome location	20q11.22
Summary	Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gam

211

Show/Hide all (211)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021922	hsa-miR-128-3p	Sequencing	20371350
MIRT022382	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT028733	hsa-miR-27a-3p	Sequencing	20371350
MIRT044047	hsa-miR-363-3p	CLASH	23622248
MIRT562422	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT562421	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT021922	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT028733	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT562420	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT562419	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562418	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562417	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562416	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562415	hsa-miR-548z	PAR-CLIP	20371350
MIRT562414	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562413	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562412	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562411	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562410	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562409	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562408	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT562407	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT562406	hsa-miR-8062	PAR-CLIP	20371350
MIRT562405	hsa-miR-6892-5p	PAR-CLIP	20371350
MIRT562404	hsa-miR-4477b	PAR-CLIP	20371350
MIRT562403	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT562422	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT562421	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT021922	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT028733	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT562420	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT562419	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562418	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562417	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562416	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562415	hsa-miR-548z	PAR-CLIP	20371350
MIRT562414	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562413	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562412	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562411	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562410	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562409	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562408	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT562407	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT562406	hsa-miR-8062	PAR-CLIP	20371350
MIRT562405	hsa-miR-6892-5p	PAR-CLIP	20371350
MIRT562404	hsa-miR-4477b	PAR-CLIP	20371350
MIRT562403	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT957297	hsa-miR-1208	CLIP-seq
MIRT957298	hsa-miR-1269	CLIP-seq
MIRT957299	hsa-miR-1269b	CLIP-seq
MIRT957300	hsa-miR-186	CLIP-seq
MIRT957301	hsa-miR-324-5p	CLIP-seq
MIRT957302	hsa-miR-339-5p	CLIP-seq
MIRT957303	hsa-miR-33a	CLIP-seq
MIRT957304	hsa-miR-33b	CLIP-seq
MIRT957305	hsa-miR-34b	CLIP-seq
MIRT957306	hsa-miR-369-3p	CLIP-seq
MIRT957307	hsa-miR-374a	CLIP-seq
MIRT957308	hsa-miR-374b	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT957310	hsa-miR-4276	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT957312	hsa-miR-450b-5p	CLIP-seq
MIRT957313	hsa-miR-4520b-3p	CLIP-seq
MIRT957314	hsa-miR-4529-3p	CLIP-seq
MIRT957315	hsa-miR-4642	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT957319	hsa-miR-4766-3p	CLIP-seq
MIRT957320	hsa-miR-4775	CLIP-seq
MIRT957321	hsa-miR-488	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT957323	hsa-miR-518a-5p	CLIP-seq
MIRT957324	hsa-miR-527	CLIP-seq
MIRT957325	hsa-miR-548p	CLIP-seq
MIRT957303	hsa-miR-33a	CLIP-seq
MIRT957304	hsa-miR-33b	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2218846	hsa-miR-29a	CLIP-seq
MIRT2218847	hsa-miR-29b	CLIP-seq
MIRT2218848	hsa-miR-29c	CLIP-seq
MIRT2218849	hsa-miR-3934	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT2218850	hsa-miR-4694-5p	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2218851	hsa-miR-4731-3p	CLIP-seq
MIRT2218852	hsa-miR-4801	CLIP-seq
MIRT2218853	hsa-miR-496	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT2218854	hsa-miR-548a-5p	CLIP-seq
MIRT2218855	hsa-miR-548ab	CLIP-seq
MIRT2218856	hsa-miR-548ae	CLIP-seq
MIRT2218857	hsa-miR-548aj	CLIP-seq
MIRT2218858	hsa-miR-548ak	CLIP-seq
MIRT2218859	hsa-miR-548am	CLIP-seq
MIRT2218860	hsa-miR-548b-5p	CLIP-seq
MIRT2218861	hsa-miR-548c-5p	CLIP-seq
MIRT2218862	hsa-miR-548d-5p	CLIP-seq
MIRT2218863	hsa-miR-548h	CLIP-seq
MIRT2218864	hsa-miR-548i	CLIP-seq
MIRT2218865	hsa-miR-548j	CLIP-seq
MIRT2218866	hsa-miR-548k	CLIP-seq
MIRT2218867	hsa-miR-548l	CLIP-seq
MIRT2218868	hsa-miR-548w	CLIP-seq
MIRT2218869	hsa-miR-548x	CLIP-seq
MIRT2218870	hsa-miR-548y	CLIP-seq
MIRT2218871	hsa-miR-552	CLIP-seq
MIRT2218872	hsa-miR-559	CLIP-seq
MIRT2522184	hsa-miR-1200	CLIP-seq
MIRT2522185	hsa-miR-1202	CLIP-seq
MIRT2522186	hsa-miR-1227	CLIP-seq
MIRT2522187	hsa-miR-150	CLIP-seq
MIRT2522188	hsa-miR-151-5p	CLIP-seq
MIRT2522189	hsa-miR-151b	CLIP-seq
MIRT2522190	hsa-miR-3160-3p	CLIP-seq
MIRT2522191	hsa-miR-3194-5p	CLIP-seq
MIRT2522192	hsa-miR-374c	CLIP-seq
MIRT2218849	hsa-miR-3934	CLIP-seq
MIRT2522193	hsa-miR-3972	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT2522194	hsa-miR-4268	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT2522195	hsa-miR-4324	CLIP-seq
MIRT2522196	hsa-miR-4426	CLIP-seq
MIRT2522197	hsa-miR-4448	CLIP-seq
MIRT2522198	hsa-miR-4487	CLIP-seq
MIRT2522199	hsa-miR-4502	CLIP-seq
MIRT2522200	hsa-miR-455-5p	CLIP-seq
MIRT2522201	hsa-miR-4647	CLIP-seq
MIRT2522202	hsa-miR-4662b	CLIP-seq
MIRT2218850	hsa-miR-4694-5p	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2522203	hsa-miR-4713-5p	CLIP-seq
MIRT2522204	hsa-miR-4714-5p	CLIP-seq
MIRT2218853	hsa-miR-496	CLIP-seq
MIRT2522205	hsa-miR-503	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT2522206	hsa-miR-532-3p	CLIP-seq
MIRT2522207	hsa-miR-544b	CLIP-seq
MIRT2218854	hsa-miR-548a-5p	CLIP-seq
MIRT2218855	hsa-miR-548ab	CLIP-seq
MIRT2218858	hsa-miR-548ak	CLIP-seq
MIRT2218860	hsa-miR-548b-5p	CLIP-seq
MIRT2522208	hsa-miR-548c-3p	CLIP-seq
MIRT2218861	hsa-miR-548c-5p	CLIP-seq
MIRT2218862	hsa-miR-548d-5p	CLIP-seq
MIRT2218863	hsa-miR-548h	CLIP-seq
MIRT2218864	hsa-miR-548i	CLIP-seq
MIRT2218865	hsa-miR-548j	CLIP-seq
MIRT2218866	hsa-miR-548k	CLIP-seq
MIRT2218867	hsa-miR-548l	CLIP-seq
MIRT2218868	hsa-miR-548w	CLIP-seq
MIRT2218870	hsa-miR-548y	CLIP-seq
MIRT2218871	hsa-miR-552	CLIP-seq
MIRT2522209	hsa-miR-558	CLIP-seq
MIRT2218872	hsa-miR-559	CLIP-seq
MIRT2522210	hsa-miR-655	CLIP-seq
MIRT2522211	hsa-miR-885-3p	CLIP-seq
MIRT2522212	hsa-miR-938	CLIP-seq
MIRT2522185	hsa-miR-1202	CLIP-seq
MIRT2522186	hsa-miR-1227	CLIP-seq
MIRT2522187	hsa-miR-150	CLIP-seq
MIRT2679877	hsa-miR-3127-3p	CLIP-seq
MIRT2522191	hsa-miR-3194-5p	CLIP-seq
MIRT2679878	hsa-miR-3664-3p	CLIP-seq
MIRT2522192	hsa-miR-374c	CLIP-seq
MIRT2218849	hsa-miR-3934	CLIP-seq
MIRT2522193	hsa-miR-3972	CLIP-seq
MIRT957309	hsa-miR-421	CLIP-seq
MIRT957311	hsa-miR-431	CLIP-seq
MIRT2522196	hsa-miR-4426	CLIP-seq
MIRT2522200	hsa-miR-455-5p	CLIP-seq
MIRT2522201	hsa-miR-4647	CLIP-seq
MIRT2522202	hsa-miR-4662b	CLIP-seq
MIRT2218850	hsa-miR-4694-5p	CLIP-seq
MIRT957316	hsa-miR-4708-3p	CLIP-seq
MIRT957317	hsa-miR-4709-5p	CLIP-seq
MIRT957318	hsa-miR-4711-5p	CLIP-seq
MIRT2522203	hsa-miR-4713-5p	CLIP-seq
MIRT2522204	hsa-miR-4714-5p	CLIP-seq
MIRT2218853	hsa-miR-496	CLIP-seq
MIRT957322	hsa-miR-505	CLIP-seq
MIRT2522206	hsa-miR-532-3p	CLIP-seq
MIRT2218854	hsa-miR-548a-5p	CLIP-seq
MIRT2218855	hsa-miR-548ab	CLIP-seq
MIRT2218858	hsa-miR-548ak	CLIP-seq
MIRT2218860	hsa-miR-548b-5p	CLIP-seq
MIRT2522208	hsa-miR-548c-3p	CLIP-seq
MIRT2218861	hsa-miR-548c-5p	CLIP-seq
MIRT2218862	hsa-miR-548d-5p	CLIP-seq
MIRT2218863	hsa-miR-548h	CLIP-seq
MIRT2218864	hsa-miR-548i	CLIP-seq
MIRT2218865	hsa-miR-548j	CLIP-seq
MIRT2218866	hsa-miR-548k	CLIP-seq
MIRT2218867	hsa-miR-548l	CLIP-seq
MIRT2218868	hsa-miR-548w	CLIP-seq
MIRT2218870	hsa-miR-548y	CLIP-seq
MIRT2218871	hsa-miR-552	CLIP-seq
MIRT2218872	hsa-miR-559	CLIP-seq
MIRT2522210	hsa-miR-655	CLIP-seq
MIRT2679879	hsa-miR-873	CLIP-seq
MIRT2522211	hsa-miR-885-3p	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEA
GO:0001731	Process	Formation of translation preinitiation complex	IBA
GO:0002176	Process	Male germ cell proliferation	IEA
GO:0002183	Process	Cytoplasmic translational initiation	IMP	31836389
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	TAS	3044606
GO:0003729	Function	MRNA binding	IBA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IDA	16289705
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11959995, 16288713, 16932749, 21745818, 22113938, 22813744, 25147208, 25609649, 28514442, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	12426392
GO:0005737	Component	Cytoplasm	IDA	12426392
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IBA
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IDA	23063529
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	IPI	31836389
GO:0005850	Component	Eukaryotic translation initiation factor 2 complex	TAS	3044606
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IDA	10563826
GO:0006413	Process	Translational initiation	IEA
GO:0008135	Function	Translation factor activity, RNA binding	TAS	3044606, 10805737
GO:0008270	Function	Zinc ion binding	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0031369	Function	Translation initiation factor binding	IBA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
603908	3266	ENSG00000125977

P20042

Protein name

Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF2-beta)

Protein function

Component of the eIF2 complex that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA (PubMed:31836389). This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form the

PDB

6K71 , 6K72 , 6YBV , 6ZMW , 6ZP4 , 7A09 , 7D43 , 7QP6 , 8OZ0 , 8PJ1 , 8PPL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01873	eIF-5_eIF-2B	192 → 308	Domain found in IF2B/IF5	Family

Sequence

MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

Sequence length

333

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	27570551		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	27570551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	12707859, 19715453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	19715453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18559534, 31119045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25151356	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	32059763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	12707859, 19715453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	36650674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	11704758, 11835386, 12707859, 14993275, 15054402, 15217090, 15723074, 16041584, 16047349, 16246152, 16246171, 16823698, 16998732, 19023445, 19158808 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	23894275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20016818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29599213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29505855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	22952606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12475790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12475790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	29294089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31727829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	19590039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	14566705, 15021247, 15054402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23894275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32154187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20016818, 29599213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23063529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30380403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	15021247, 15054402, 15136673, 15723074, 16041584, 16378743, 18005052, 18263758, 18519871, 18678442, 20016818, 20958979, 22678813, 22737209, 22952606 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	20016818, 32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	12499492, 14566705, 21560189, 24938145, 26625702, 30720246		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	18596980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23894275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29294089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29624814	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18559534, 31119045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22446383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10216939, 29036434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25151356		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28096186		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, EPILEPTIC SEIZURES, HYPOGONADISM AND HYPOGENITALISM, MICROCEPHALY, AND OBESITY (disorder)	Mental retardation	BEFREE	30517694, 31836389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18632786, 26671108, 28093708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	28692326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30538549		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	22238342, 26614666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	14729329, 15060152, 16246171, 22678813, 23335982, 28306143, 28597716, 29036434, 29489452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29624814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29899429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	15021247		★★★★★ ★☆☆☆☆ Found in Text Mining only
OVARIOLEUKODYSTROPHY	Ovarioleukodystrophy	BEFREE	15054402, 18005052, 18061208, 18263758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38538250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15986317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	15021247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19834500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	29294089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23894275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29294089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35669725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vanishing White Matter Leukodystrophy with Ovarian Failure	Vanishing white matter disease	Pubtator	20016818, 32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolcott-Rallison syndrome	Wolcott-Rallison Syndrome	BEFREE	12475790		★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF2S2 (eukaryotic translation initiation factor 2 subunit beta)