Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1939
Gene name	Eukaryotic translation initiation factor 2D
Gene symbol	EIF2D
Synonyms (NCBI Gene)	HCA56LGTN
Chromosome	1
Chromosome location	1q32.1
Summary	This gene encodes a translation initiation factor involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. This gene was previously referred to as ligatin, but is now known to locali

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001731	Process	Formation of translation preinitiation complex	IBA
GO:0001731	Process	Formation of translation preinitiation complex	IDA	20713520
GO:0001731	Process	Formation of translation preinitiation complex	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IDA	20566627
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005737	Component	Cytoplasm	IDA	20566627
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IEA
GO:0006886	Process	Intracellular protein transport	TAS
GO:0016604	Component	Nuclear body	IDA
GO:0032790	Process	Ribosome disassembly	IDA	20713520
GO:0038023	Function	Signaling receptor activity	TAS
GO:0043933	Process	Protein-containing complex organization	IEA
GO:0075522	Process	IRES-dependent viral translational initiation	IDA	20713520

MIM	HGNC	e!Ensembl
613709	6583	ENSG00000143486

P41214

Protein name

Eukaryotic translation initiation factor 2D (eIF2d) (Hepatocellular carcinoma-associated antigen 56) (Ligatin)

Protein function

Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situati

PDB

5OA3 , 5OA9 , 5W2F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01253	SUI1	487 → 567	Translation initiation factor SUI1	Domain
PF17832	Pre-PUA	2 → 90	Pre-PUA-like domain	Domain

Sequence

MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNIVKLYAHKGDA
VTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMP
PAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSG
NKSSPPSIAPLALDSADLSEEKGSVQMDSTLQGDMRHMTLEGEEENGEVHQAREDKSLSE
APEDTSTRGLNQDSTDSKTLQEQMDELLQQCFLHALKCRVKKADLPLLTSTFLGSHMFSC
CPEGRQLDIKKSSYKKLSKFLQQMQQEQIIQVKELSKGVESIVAVDWKHPRITSFVIPEP
SPTSQTIQEGSREQPYHPPDIKPLYCVPASMTLLFQESGHKKGSFLEGSEVRTIVINYAK
KNDLVDADNKNLVRLDPILCDCILEKNEQHTVMKLPWDSLLTRCLEKLQPAYQVTLPGQE
PIVKKGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGA
KDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK

Sequence length

584

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	37354922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	30958601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	30958601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	30958601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31078689		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with EIF2D across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for EIF2D.

Diseases Linked via Similar Genes Diseases curated for genes most similar to EIF2D (see Related Genes above), that are NOT already directly curated for EIF2D itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to EIF2D.

EIF2D (eukaryotic translation initiation factor 2D)

Bookmark This Gene