Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	493861
Gene name	EP300 interacting inhibitor of differentiation 3
Gene symbol	EID3
Synonyms (NCBI Gene)	NS4EBNSE4BNSMCE4B
Chromosome	12
Chromosome location	12q23.3

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	NAS	16810316
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000781	Component	Chromosome, telomeric region	NAS	17589526
GO:0005515	Function	Protein binding	IPI	21364888, 28514442, 32389690, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006310	Process	DNA recombination	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0016925	Process	Protein sumoylation	NAS	32389690
GO:0030915	Component	Smc5-Smc6 complex	IBA
GO:0030915	Component	Smc5-Smc6 complex	IDA	18086888
GO:0030915	Component	Smc5-Smc6 complex	IEA
GO:0030915	Component	Smc5-Smc6 complex	NAS	32389690
GO:0032204	Process	Regulation of telomere maintenance	NAS	17589526
GO:0140588	Process	Chromatin looping	NAS	32389690

MIM	HGNC	e!Ensembl
612986	32961	ENSG00000255150

Q8N140

Protein name

EP300-interacting inhibitor of differentiation 3 (EID-3) (E1A-like inhibitor of differentiation 3) (EID-1-like inhibitor of differentiation 3) (Non-structural maintenance of chromosomes element 4 homolog B) (NS4EB) (Non-SMC element 4 homolog B)

Protein function

Tissue-specific component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin compl

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08743	Nse4_C	239 → 330	Nse4 C-terminal	Domain
PF15412	Nse4-Nse3_bdg	89 → 146	Binding domain of Nse4/EID3 to Nse3-MAGE	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis. {ECO:0000269|PubMed:15987788}.

Sequence

MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVS
SANNSLTEALEEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSDMNFFNQLAFC
DFLFLFVGLNWMEGDPDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERS
APKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEATEKNVERILGLLQTYFRKYPDTPV
SYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRLPILEPMNVNQMGEGNDSSCH
GRKQGVISLTLQEWKNIVAAFEISEAMITYSSY

Sequence length

333

Interactions

View interactions

Reactome Pathway
SUMOylation of DNA damage response and repair proteins

Related Genes Genes most often co-reported with EID3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for EID3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to EID3 (see Related Genes above), that are NOT already directly curated for EID3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to EID3.

EID3 (EP300 interacting inhibitor of differentiation 3)

Bookmark This Gene