EID2 (EP300 interacting inhibitor of differentiation 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 163126
• Gene name: EP300 interacting inhibitor of differentiation 2
• Gene symbol: EID2
• Synonyms (NCBI Gene): CRI2, EID-2
• Chromosome: 19
• Chromosome location: 19q13.2

miRNA Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT644718	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT644717	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT644714	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT662430	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT644719	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT644718	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT644717	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT644716	hsa-miR-200c-5p	HITS-CLIP	23824327
MIRT644715	hsa-miR-550a-3p	HITS-CLIP	23824327
MIRT644714	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT644718	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT644717	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT644714	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT662430	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT644719	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT644718	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT644717	hsa-miR-1914-5p	HITS-CLIP	23824327
MIRT644716	hsa-miR-200c-5p	HITS-CLIP	23824327
MIRT644715	hsa-miR-550a-3p	HITS-CLIP	23824327
MIRT644714	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT955849	hsa-miR-155	CLIP-seq
MIRT955850	hsa-miR-1909	CLIP-seq
MIRT955851	hsa-miR-3133	CLIP-seq
MIRT955852	hsa-miR-3148	CLIP-seq
MIRT955853	hsa-miR-3160-5p	CLIP-seq
MIRT955854	hsa-miR-3182	CLIP-seq
MIRT955855	hsa-miR-3682-5p	CLIP-seq
MIRT955856	hsa-miR-374a	CLIP-seq
MIRT955857	hsa-miR-374b	CLIP-seq
MIRT955858	hsa-miR-4491	CLIP-seq
MIRT955859	hsa-miR-4657	CLIP-seq
MIRT955860	hsa-miR-4668-5p	CLIP-seq
MIRT955861	hsa-miR-4677-3p	CLIP-seq
MIRT955862	hsa-miR-4679	CLIP-seq
MIRT955863	hsa-miR-4716-3p	CLIP-seq
MIRT955864	hsa-miR-582-5p	CLIP-seq
MIRT955865	hsa-miR-587	CLIP-seq
MIRT955866	hsa-miR-625	CLIP-seq
MIRT955867	hsa-miR-888	CLIP-seq
MIRT1983142	hsa-miR-4663	CLIP-seq
MIRT1983143	hsa-miR-4728-3p	CLIP-seq
MIRT955865	hsa-miR-587	CLIP-seq
MIRT2218308	hsa-miR-4699-3p	CLIP-seq
MIRT2387302	hsa-miR-548aa	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	14612439
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	15970276
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	14612439
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0007181	Process	Transforming growth factor beta receptor complex assembly	IDA	14612439
GO:0007517	Process	Muscle organ development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	14612439
GO:0042127	Process	Regulation of cell population proliferation	IDA	14612439
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0046332	Function	SMAD binding	IDA	14612439
GO:0046332	Function	SMAD binding	IPI	14612439
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	14612439

Other IDs

• MIM: 609773
• HGNC: 28292
• e!Ensembl: ENSG00000176396

Protein

• UniProt ID: Q8N6I1
• Protein name: EP300-interacting inhibitor of differentiation 2 (EID-2) (CREBBP/EP300 inhibitor 2) (EID-1-like inhibitor of differentiation 2)
• Protein function: Interacts with EP300 and acts as a repressor of MYOD-dependent transcription and muscle differentiation. Inhibits EP300 histone acetyltransferase activity. Acts as a repressor of TGFB/SMAD transcriptional responses. May act as a repressor of the
• Tissue specificity: TISSUE SPECIFICITY: Most abundantly expressed in placenta. Highly expressed in liver, brain, heart, skeletal muscle, and kidney. {ECO:0000269|PubMed:14585496}.
• Sequence:

  MSKLPADSSVPQTGAANGDRDVPQAEVGRGRREPAPAQPEEAGEGAMAAARGGPVPAARE
  GRMAAARAAPAAAARGAPVAAAALARAAAAGRESPAAAAAREARMAEVARLLGEPVDEEG
  PEGRPRSRHGNGGLAALPYLRLRHPLSVLGINYQQFLRHYLENYPIAPGRIQELEERRRR
  FVEACRAREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE

• Sequence length: 236

Related Genes

No strongly related genes found yet for EID2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to EID2.