EGFL7 (EGF like domain multiple 7)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51162
Gene name EGF like domain multiple 7
Gene symbol EGFL7
Synonyms (NCBI Gene)
NEU1VE-STATINZNEU1
Chromosome 9
Chromosome location 9q34.3
Summary This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Al
miRNA miRNA information provided by mirtarbase database.
18 Show/Hide all (18)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT006558 hsa-miR-126-3p FlowImmunoblotImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 20034472
MIRT006558 hsa-miR-126-3p Western blot;qRT-PCR;Other 20034472
MIRT006558 hsa-miR-126-3p Reporter assay 21249429
MIRT021710 hsa-miR-133a-3p Reporter assay 21249429
MIRT044066 hsa-miR-361-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001568 Process Blood vessel development ISS
GO:0001570 Process Vasculogenesis IBA
GO:0001570 Process Vasculogenesis ISS
GO:0001938 Process Positive regulation of endothelial cell proliferation IMP 20947685
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608582 20594 ENSG00000172889
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UHF1
Protein name Epidermal growth factor-like protein 7 (EGF-like protein 7) (Multiple epidermal growth factor-like domains protein 7) (Multiple EGF-like domains protein 7) (NOTCH4-like protein) (Vascular endothelial statin) (VE-statin) (Zneu1)
Protein function Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis. {ECO:0000269|PubMed:23386126, E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07546 EMI 28 → 94 EMI domain Domain
PF07645 EGF_CA 137 → 176 Calcium-binding EGF domain Domain
PF07974 EGF_2 102 → 134 EGF-like domain Domain
Sequence 
MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP
GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG
GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL
VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Sequence length 273
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Hepatocellular carcinoma Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (189)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Action Myoclonus-Renal Failure Syndrome Action Myoclonus-Renal Failure Syndrome CTD_human_DG 25401298
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 1347282, 1962774, 1970152, 27259812
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer BEFREE 15753987
★★★★★
★☆☆☆☆
Found in Text Mining only
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 28677353
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 32989152 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anodontia Anodontia Pubtator 26497328 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 26799121, 29371126, 30097518
★★★★★
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 8826951
★★★★★
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 26799121, 29371126, 30097518
★★★★★
★☆☆☆☆
Found in Text Mining only
Atypical Inclusion-Body Disease Inclusion-Body Disease CTD_human_DG 25401298
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for EGFL7.

No additional diseases found yet through genes similar to EGFL7.