EGFEM1P (EGF like and EMI domain containing 1, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 93556
Gene name EGF like and EMI domain containing 1, pseudogene
Gene symbol EGFEM1P
Synonyms (NCBI Gene)
C3orf50NCRNA00259
Chromosome 3
Chromosome location 3q26.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005044 Function Scavenger receptor activity IEA
GO:0016192 Process Vesicle-mediated transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 25149 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q0D2K5
Protein name Putative EGF-like and EMI domain-containing protein 1
Family and domains
Sequence 
MDELRWYHITVCLDHIFGHNCSLSCKDCMNGGKCQEGKSECSCPAGCRVILCNENCLEGA
YGAGCTSECQCVEENTLECSAKNGSCTCKSGYQGNRCQKDGLWGPEGWFSSAPCENGGQC
NKKTGNCDCTPDYTRKSCTILRCISLTNLALSRRSSPMKYQQNVSSHREVRQRQQCSSDR
PFKKLLCKFSFKIGM
Sequence length 195
Interactions View interactions

No strongly related genes found yet for EGFEM1P.

No additional diseases found yet through genes similar to EGFEM1P.