Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	285588
Gene name	EF-hand calcium binding domain 9
Gene symbol	EFCAB9
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q35.1
Summary	This gene encodes a protein with a C-terminal EF-hand calcium-binding domain similar to that found in penta-EF-hand (PEF) protein family members. The EF-hand is a helix-loop-helix structure with a canonical twelve-residue sequence that coordinates a calci

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0030317	Process	Flagellated sperm motility	IBA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036128	Component	CatSper complex	IEA
GO:0036128	Component	CatSper complex	ISS
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048240	Process	Sperm capacitation	IBA
GO:0048240	Process	Sperm capacitation	IEA
GO:0048240	Process	Sperm capacitation	ISS
GO:0061891	Function	Calcium ion sensor activity	IBA
GO:0061891	Function	Calcium ion sensor activity	IEA
GO:0061891	Function	Calcium ion sensor activity	ISS
GO:0097228	Component	Sperm principal piece	IBA
GO:0097228	Component	Sperm principal piece	IEA
GO:0097228	Component	Sperm principal piece	ISS

MIM	HGNC	e!Ensembl
618520	34530	ENSG00000214360

A8MZ26

Protein name

EF-hand calcium-binding domain-containing protein 9

Protein function

Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation. pH-dependent Ca(2+) sensor required to activate the CatSper channel. Sperm cell hyperactivation is needed for sperm motility which is essential late in

Family and domains

Sequence

MRLKQGSFLWYLYLDKIYCLLSVRNVKALAEYFHILDVHGKNTLNDVLFYHFLHHVTDLK
KAQINIVFDMLDWNAVGEIDFEKFYMLVCMLLAHQNHLEGQFMYRHSRPVFDLLDLKGDL
RIGAKNFEMYRFLFNIQKQELKDLFRDFDITGDNRLNYQEFKLYTIIYTDKLQKRQKTEE
KEKGERKRSLYSKCHIK

Sequence length

197

Interactions

View interactions

Related Genes Genes most often co-reported with EFCAB9 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for EFCAB9.

Diseases Linked via Similar Genes Diseases curated for genes most similar to EFCAB9 (see Related Genes above), that are NOT already directly curated for EFCAB9 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to EFCAB9.

EFCAB9 (EF-hand calcium binding domain 9)

Save This Analysis