EEF1DP3 (eukaryotic translation elongation factor 1 delta pseudogene 3)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 196549 |
| Gene name | Eukaryotic translation elongation factor 1 delta pseudogene 3 |
| Gene symbol | EEF1DP3 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 13 |
| Chromosome location | 13q13.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q658K8 |
| Protein name | Putative elongation factor 1-delta-like protein (Putative EF-1-delta-like pseudogene 3 protein) |
| Family and domains | |
| Sequence |
MATNFLVGEKIWFHKFKYGDAERRFYEQMNGPVAGASLQEASMILHDIARARENIPKSLA |
| Sequence length | 133 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with EEF1DP3 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to EEF1DP3 (see Related Genes above), that are NOT already directly curated for EEF1DP3 itself -- a lead worth checking, not a confirmed association.
0
|
|