ECSCR (endothelial cell surface expressed chemotaxis and apoptosis regulator)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 641700
Gene name Endothelial cell surface expressed chemotaxis and apoptosis regulator
Gene symbol ECSCR
Synonyms (NCBI Gene)
ARIAECSM2
Chromosome 5
Chromosome location 5q31.2
Summary The protein encoded by this gene is primarily found in endothelial cells and blood vessels, where it is involved in cell shape changes and EGF-induced cell migration. It can enhance the activation of vascular endothelial growth factor receptor-2/kinase in
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT951805 hsa-miR-3692 CLIP-seq
MIRT951806 hsa-miR-646 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19 Show/Hide all (19)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0005515 Function Protein binding IPI 19416853, 21593423
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615736 35454 ENSG00000249751
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q19T08
Protein name Endothelial cell-specific chemotaxis regulator (Apoptosis regulator through modulating IAP expression) (ARIA) (Endothelial cell-specific molecule 2)
Protein function Regulates endothelial chemotaxis and tube formation. Has a role in angiogenesis and apoptosis via modulation of the actin cytoskeleton and facilitation of proteasomal degradation of the apoptosis inhibitors BIRC3/IAP1 and BIRC2/IAP2. {ECO:000026
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15820 ECSCR 101 → 203 Endothelial cell-specific chemotaxis regulator Family
Tissue specificity TISSUE SPECIFICITY: Highest expression in endothelial cells. Also detected in vascular smooth muscle, macrophages, lymphocytes, and mast cells. {ECO:0000269|PubMed:18556573, ECO:0000269|PubMed:19416853}.
Sequence 
MGTAGAMQLCWVILGFLLFRGHNSQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEA
NRPSHLSSTGTPGAGVPSSGRDGGTSRDTFQTVPPNSTTMSLSMREDATILPSPTSETVL
TVAAFGVISFIVILVVVVIILVGVVSLRFKCRKSKESEDPQKPGSSGLSESCSTANGEKD
SITLISMKNINMNNGKQSLSAEKVL
Sequence length 205
Interactions View interactions

No strongly related genes found yet for ECSCR.

No additional diseases found yet through genes similar to ECSCR.