DYNLT2 (dynein light chain Tctex-type 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 6991
Gene name Dynein light chain Tctex-type 2
Gene symbol DYNLT2
Synonyms (NCBI Gene)
TCTE3TCTEX1D3TCTEX2Tctex4oda12
Chromosome 6
Chromosome location 6q27
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005868 Component Cytoplasmic dynein complex IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
186977 11695 ENSG00000184786
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IZS6
Protein name Dynein light chain Tctex-type protein 2 (T-complex testis-specific protein 3) (T-complex-associated testis-expressed protein 3) (Tcte-3) (Tctex1 domain-containing protein 3)
Protein function May be an accessory component of axonemal dynein and cytoplasmic dynein 1 (PubMed:11278908, PubMed:12584439). Candidate for involvement in male sterility (By similarity). {ECO:0000250|UniProtKB:P11985, ECO:0000269|PubMed:11278908, ECO:0000269|Pu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03645 Tctex-1 99 → 196 Tctex-1 family Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in testis. Also expressed in brain, lung and trachea. {ECO:0000269|PubMed:11278908, ECO:0000269|PubMed:12584439}.
Sequence 
MEKRGRGVKSSPIQTPNQTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVE
PPFDDSIADIGKEWKSALAKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDK
VFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAK
HEAESYVALVLVFALYYE
Sequence length 198
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Motor proteins Intraflagellar transport

No strongly related genes found yet for DYNLT2.

No additional diseases found yet through genes similar to DYNLT2.