DYDC1 (DPY30 domain containing 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 143241
Gene name DPY30 domain containing 1
Gene symbol DYDC1
Synonyms (NCBI Gene)
DPY30D1
Chromosome 10
Chromosome location 10q23.1
Summary This gene encodes a member of a family of proteins that contains a DPY30 domain. The encoded protein is involved in acrosome formation during spermatid development. This gene locus overlaps with a closely related gene on the opposite strand. Alternative s
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017482 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001534 Component Radial spoke ISS
GO:0005515 Function Protein binding IPI 16189514, 25416956, 26871637, 31515488, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005929 Component Cilium IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615154 23460 ENSG00000170788
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WWB3
Protein name DPY30 domain-containing protein 1
Protein function Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia (By similarity). Plays a crucial role during acrosome biogenesis (PubMed:19545932). {ECO:0000250|UniProtKB:Q9D9T0, ECO:0000269|Pu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05186 Dpy-30 1 → 42 Dpy-30 motif Motif
Tissue specificity TISSUE SPECIFICITY: Brain and testis. Accumulates during late stage of spermiogenesis. {ECO:0000269|PubMed:19545932}.
Sequence 
MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERE
RELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNM
ENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL
Sequence length 177
Interactions View interactions

No strongly related genes found yet for DYDC1.

No additional diseases found yet through genes similar to DYDC1.