DUXB (double homeobox B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100033411
Gene name Double homeobox B
Gene symbol DUXB
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16q23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618698 33345 ENSG00000282757
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1W2PPF3
Protein name Double homeobox protein B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 16 → 72 Homeodomain Domain
PF00046 Homeodomain 103 → 159 Homeodomain Domain
Sequence 
MNLEGTSGGILQKEFWRNRIQYNQSQKDILQSWFQHDPFPDKAAREQLAKEIGVPESNIQ
VWFKNYRVKQRKLDYKCFSEKDQTQGHDQSQHLTQEYLPKEARQKQTFITWTQKNRLVQA
FERNPFPDIATRKKLAEQTGLQESRIQMWFQKQRSLYLKKSRMEPMNLLVDDPNERPDAT
VGWHPINLFLPTDSSHYFSCSHSSSGHETLPPVLPSTQAPWDPFRFHVSQGPNVMIMQPT
QAVQEGEKSDQPLIIPNHLLTLPILTKDLDTPTPFWLQYQEEHQNHKEHSGSGVPQVKSH
SQPEPEHREQQPLNLGQFDISNILQRWDEICQALLAEWDPLKGTH
Sequence length 345
Interactions View interactions

No strongly related genes found yet for DUXB.

No additional diseases found yet through genes similar to DUXB.