DUX5 (double homeobox 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 26581
Gene name Double homeobox 5
Gene symbol DUX5
Synonyms (NCBI Gene)
DUX1
Chromosome 14
Chromosome location -
Summary The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX5, resides within these 3.3-kb repeated elements (Beckers et al., 2001 [PubMed 11245978]). See DUX4 (MIM 60600
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611444 3083 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96PT3
Protein name Double homeobox protein 5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 122 → 178 Homeodomain Domain
PF00046 Homeodomain 47 → 103 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in hepatoma Hep3B cells. {ECO:0000269|PubMed:11245978}.
Sequence 
MPAEVHGSPPASLCPCQSVKFRPGLPEMALLTALDDTLPEEAQGPGRRMILLSTPSQSDA
LRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQK
GRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQS
GRAPTQASIRCNAAPIG
Sequence length 197
Interactions View interactions

No strongly related genes found yet for DUX5.

No additional diseases found yet through genes similar to DUX5.