Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	1848
Gene name	Dual specificity phosphatase 6
Gene symbol	DUSP6
Synonyms (NCBI Gene)	HH19MKP3PYST1
Chromosome	12
Chromosome location	12q21.33
Summary	The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs139318648	G>A,C	Risk-factor	Missense variant, intron variant, coding sequence variant
rs143946794	T>C	Pathogenic	Missense variant, intron variant, coding sequence variant
rs146089505	G>A	Risk-factor	Missense variant, coding sequence variant
rs587776978	A>T	Pathogenic	Coding sequence variant, missense variant

269

Show/Hide all (269)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT006481	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	17382377
MIRT018633	hsa-miR-335-5p	Microarray	18185580
MIRT020032	hsa-miR-375	Microarray	20215506
MIRT438607	hsa-miR-125b-5p	Luciferase reporter assayWestern blotqRT-PCR	25001178
MIRT438607	hsa-miR-125b-5p	Luciferase reporter assayWestern blotqRT-PCR	25001178
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT658838	hsa-miR-300	HITS-CLIP	23824327
MIRT658837	hsa-miR-381-3p	HITS-CLIP	23824327
MIRT658836	hsa-miR-4666a-3p	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT615027	hsa-let-7a-3p	HITS-CLIP	23824327
MIRT615026	hsa-let-7b-3p	HITS-CLIP	23824327
MIRT615025	hsa-let-7f-1-3p	HITS-CLIP	23824327
MIRT615024	hsa-miR-98-3p	HITS-CLIP	23824327
MIRT615023	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT615022	hsa-let-7f-2-3p	HITS-CLIP	23824327
MIRT615021	hsa-miR-1185-1-3p	HITS-CLIP	23824327
MIRT615020	hsa-miR-1185-2-3p	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT615027	hsa-let-7a-3p	HITS-CLIP	23824327
MIRT615026	hsa-let-7b-3p	HITS-CLIP	23824327
MIRT615025	hsa-let-7f-1-3p	HITS-CLIP	23824327
MIRT615024	hsa-miR-98-3p	HITS-CLIP	23824327
MIRT615023	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT615022	hsa-let-7f-2-3p	HITS-CLIP	23824327
MIRT615021	hsa-miR-1185-1-3p	HITS-CLIP	23824327
MIRT615020	hsa-miR-1185-2-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT006481	hsa-miR-181a-5p	FlowMicroarrayqRT-PCR	25477247
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT658838	hsa-miR-300	HITS-CLIP	23824327
MIRT658837	hsa-miR-381-3p	HITS-CLIP	23824327
MIRT658836	hsa-miR-4666a-3p	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT615027	hsa-let-7a-3p	HITS-CLIP	23824327
MIRT615026	hsa-let-7b-3p	HITS-CLIP	23824327
MIRT615025	hsa-let-7f-1-3p	HITS-CLIP	23824327
MIRT615024	hsa-miR-98-3p	HITS-CLIP	23824327
MIRT615023	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT615022	hsa-let-7f-2-3p	HITS-CLIP	23824327
MIRT615021	hsa-miR-1185-1-3p	HITS-CLIP	23824327
MIRT615020	hsa-miR-1185-2-3p	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT624078	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT624077	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT615027	hsa-let-7a-3p	HITS-CLIP	23824327
MIRT615026	hsa-let-7b-3p	HITS-CLIP	23824327
MIRT615025	hsa-let-7f-1-3p	HITS-CLIP	23824327
MIRT615024	hsa-miR-98-3p	HITS-CLIP	23824327
MIRT615023	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT615022	hsa-let-7f-2-3p	HITS-CLIP	23824327
MIRT615021	hsa-miR-1185-1-3p	HITS-CLIP	23824327
MIRT615020	hsa-miR-1185-2-3p	HITS-CLIP	23824327
MIRT613137	hsa-miR-5195-3p	HITS-CLIP	23824327
MIRT613136	hsa-miR-145-5p	HITS-CLIP	23824327
MIRT613135	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT613134	hsa-miR-8485	HITS-CLIP	23824327
MIRT613133	hsa-miR-603	HITS-CLIP	23824327
MIRT613132	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT613131	hsa-miR-4328	HITS-CLIP	23824327
MIRT756268	hsa-miR-101-5p	Luciferase reporter assayWestern blottingqRT-PCR	37300650
MIRT948222	hsa-miR-2114	CLIP-seq
MIRT2215976	hsa-miR-125a-5p	CLIP-seq
MIRT2215977	hsa-miR-125b	CLIP-seq
MIRT2215978	hsa-miR-1273c	CLIP-seq
MIRT2215979	hsa-miR-1284	CLIP-seq
MIRT2215980	hsa-miR-3121-5p	CLIP-seq
MIRT2215981	hsa-miR-3185	CLIP-seq
MIRT2215982	hsa-miR-3683	CLIP-seq
MIRT2215983	hsa-miR-4257	CLIP-seq
MIRT2215984	hsa-miR-4319	CLIP-seq
MIRT2215985	hsa-miR-450a	CLIP-seq
MIRT2215986	hsa-miR-452	CLIP-seq
MIRT2215987	hsa-miR-4676-3p	CLIP-seq
MIRT2215988	hsa-miR-4731-3p	CLIP-seq
MIRT2215989	hsa-miR-4732-3p	CLIP-seq
MIRT2215990	hsa-miR-4753-3p	CLIP-seq
MIRT2215991	hsa-miR-4797-5p	CLIP-seq
MIRT2215992	hsa-miR-4801	CLIP-seq
MIRT2215993	hsa-miR-548p	CLIP-seq
MIRT2215994	hsa-miR-590-3p	CLIP-seq
MIRT2215995	hsa-miR-670	CLIP-seq
MIRT2215976	hsa-miR-125a-5p	CLIP-seq
MIRT2215977	hsa-miR-125b	CLIP-seq
MIRT2428409	hsa-miR-145	CLIP-seq
MIRT2428410	hsa-miR-3117-5p	CLIP-seq
MIRT2215981	hsa-miR-3185	CLIP-seq
MIRT2428411	hsa-miR-369-3p	CLIP-seq
MIRT2428412	hsa-miR-374a	CLIP-seq
MIRT2428413	hsa-miR-374b	CLIP-seq
MIRT2428414	hsa-miR-377	CLIP-seq
MIRT2428415	hsa-miR-381	CLIP-seq
MIRT2215983	hsa-miR-4257	CLIP-seq
MIRT2428416	hsa-miR-4267	CLIP-seq
MIRT2215984	hsa-miR-4319	CLIP-seq
MIRT2215986	hsa-miR-452	CLIP-seq
MIRT2428417	hsa-miR-4666-3p	CLIP-seq
MIRT2215987	hsa-miR-4676-3p	CLIP-seq
MIRT2215989	hsa-miR-4732-3p	CLIP-seq
MIRT2215991	hsa-miR-4797-5p	CLIP-seq
MIRT2215994	hsa-miR-590-3p	CLIP-seq
MIRT2215995	hsa-miR-670	CLIP-seq
MIRT2215976	hsa-miR-125a-5p	CLIP-seq
MIRT2215977	hsa-miR-125b	CLIP-seq
MIRT2520151	hsa-miR-140-3p	CLIP-seq
MIRT2428409	hsa-miR-145	CLIP-seq
MIRT2520152	hsa-miR-216b	CLIP-seq
MIRT2520153	hsa-miR-223	CLIP-seq
MIRT2428410	hsa-miR-3117-5p	CLIP-seq
MIRT2520154	hsa-miR-3160-3p	CLIP-seq
MIRT2520155	hsa-miR-3180-5p	CLIP-seq
MIRT2215981	hsa-miR-3185	CLIP-seq
MIRT2428414	hsa-miR-377	CLIP-seq
MIRT2428415	hsa-miR-381	CLIP-seq
MIRT2215983	hsa-miR-4257	CLIP-seq
MIRT2520156	hsa-miR-4261	CLIP-seq
MIRT2520157	hsa-miR-4268	CLIP-seq
MIRT2520158	hsa-miR-4277	CLIP-seq
MIRT2215984	hsa-miR-4319	CLIP-seq
MIRT2520159	hsa-miR-4452	CLIP-seq
MIRT2520160	hsa-miR-4474-5p	CLIP-seq
MIRT2520161	hsa-miR-4496	CLIP-seq
MIRT2215986	hsa-miR-452	CLIP-seq
MIRT2428417	hsa-miR-4666-3p	CLIP-seq
MIRT2215987	hsa-miR-4676-3p	CLIP-seq
MIRT2520162	hsa-miR-4690-3p	CLIP-seq
MIRT2520163	hsa-miR-4709-3p	CLIP-seq
MIRT2520164	hsa-miR-4719	CLIP-seq
MIRT2215989	hsa-miR-4732-3p	CLIP-seq
MIRT2215990	hsa-miR-4753-3p	CLIP-seq
MIRT2215991	hsa-miR-4797-5p	CLIP-seq
MIRT2520165	hsa-miR-493	CLIP-seq
MIRT2520166	hsa-miR-520a-5p	CLIP-seq
MIRT2520167	hsa-miR-525-5p	CLIP-seq
MIRT2215994	hsa-miR-590-3p	CLIP-seq
MIRT2215995	hsa-miR-670	CLIP-seq
MIRT2520168	hsa-miR-9	CLIP-seq
MIRT2520151	hsa-miR-140-3p	CLIP-seq
MIRT2520152	hsa-miR-216b	CLIP-seq
MIRT2520154	hsa-miR-3160-3p	CLIP-seq
MIRT2520157	hsa-miR-4268	CLIP-seq
MIRT2520159	hsa-miR-4452	CLIP-seq
MIRT2520164	hsa-miR-4719	CLIP-seq
MIRT2215990	hsa-miR-4753-3p	CLIP-seq
MIRT2215991	hsa-miR-4797-5p	CLIP-seq
MIRT2520168	hsa-miR-9	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ETS1	Unknown	20097731

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS
GO:0005515	Function	Protein binding	IPI	12840032, 18060821, 27880917, 31980649, 32296183, 32707033, 32721402, 32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	8670865, 9788880
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IBA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IEA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	TAS
GO:0008330	Function	Protein tyrosine/threonine phosphatase activity	IBA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IDA	8670865
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0033550	Function	MAP kinase tyrosine phosphatase activity	IBA
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	8670865
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	10846176
GO:0043409	Process	Negative regulation of MAPK cascade	IDA	8670865
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0051409	Process	Response to nitrosative stress	IEP	10846176
GO:0060420	Process	Regulation of heart growth	IBA
GO:0060420	Process	Regulation of heart growth	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	TAS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	18771677
GO:0070848	Process	Response to growth factor	IEA

MIM	HGNC	e!Ensembl
602748	3072	ENSG00000139318

Q16828

Protein name

Dual specificity protein phosphatase 6 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase PYST1) (Mitogen-activated protein kinase phosphatase 3) (MAP kinase phosphatase 3) (MKP-3)

Protein function

Dual specificity protein phosphatase, which mediates dephosphorylation and inactivation of MAP kinases (PubMed:8670865). Has a specificity for the ERK family (PubMed:8670865). Plays an important role in alleviating chronic postoperative pain (By

PDB

1HZM , 1MKP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	19 → 142	Rhodanese-like domain	Domain
PF00782	DSPc	214 → 346	Dual specificity phosphatase, catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in keratinocytes (at protein level). {ECO:0000269|PubMed:29043977}.

Sequence

MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTTPSNQNVYQVDSLQST

Sequence length

381

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypogonadotropic hypogonadism 19 with or without anosmia	Pathogenic	rs1879213059	RCV001335884	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (33)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUSP6-related disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM	—	Disgenet Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM 7 WITH OR WITHOUT ANOSMIA	—	ClinVar, HPO ClinVar, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC GROWTH HORMONE DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC HYPOGONADOTROPIC HYPOGONADISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KALLMANN SYNDROME	—	Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANHYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY DWARFISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY SHORT STATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHEEHAN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (155)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15824892, 16367914, 21680106, 23419500, 29578153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21680106, 26301689, 30475204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30572643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior hypopituitarism	Hypopituitarism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22797469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	22535643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11032376, 22155192, 27216486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11032376, 17239488, 22155192		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	16491131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25201346, 26859151, 27555661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20413845, 20554528, 23921636, 25201346, 26859151, 34970732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	37681336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15832194, 19608870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31553703	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal	Ductal carcinoma	Pubtator	15832194	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	12759238	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	15832194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19608870, 20097731, 28231233, 29578153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22427941, 27613525, 29578153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31164954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24184689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	23643382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31557398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	23965468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30273442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25339833, 29270670, 29368606, 33658394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30273442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of breast	Breast hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of ovary	Hypoplasia of the ovary	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	30577494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	15496935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16126724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	25014566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	15832194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	23419500, 31553703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20638106, 31553703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20638106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31553703	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29630097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	31985475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	17910586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	17910586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31164954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31553703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Female hypogonadism syndrome	Female Hypogonadism Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	21499306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21499306		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	21499306		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	32771050, 35441887, 36814929	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	21499306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	21499306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29765028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	40508017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26859151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26097584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	26097584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29062272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	37108593, 40508017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM 19 WITH OR WITHOUT ANOSMIA	Hypogonadotropic Hypogonadism With Or Without Anosmia	GENOMICS_ENGLAND_DG	23643382		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HYPOGONADOTROPIC HYPOGONADISM 19 WITH OR WITHOUT ANOSMIA	Hypogonadotropic Hypogonadism With Or Without Anosmia	UNIPROT_DG	23643382		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HYPOGONADOTROPIC HYPOGONADISM 19 WITH OR WITHOUT ANOSMIA	Hypogonadotropic Hypogonadism With Or Without Anosmia	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HYPOGONADOTROPIC HYPOGONADISM 19 WITH OR WITHOUT ANOSMIA	Hypogonadotropic Hypogonadism With Or Without Anosmia	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ichthyoses	Ichthyosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kallmann Syndrome	Kallmann Syndrome	ORPHANET_DG	23643382		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kallmann syndrome	Kallmann Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kallmann Syndrome	Kallmann syndrome	Pubtator	37108593	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	30075554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16126724, 30850165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16126724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19608870	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20097731, 28231233, 29578153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25201346, 27555661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20638106, 31553703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19608870, 20097731, 28231233, 29578153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12759238, 15084966, 15824892, 15832194, 19896096, 20638106, 23063941, 9858808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25241655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24716913, 29050982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24222120, 28910386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14767517, 21387288, 21680106, 25241655, 29307852, 29545965, 30475204, 31238530, 31553703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	30936125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malocclusion	Malocclusion	Pubtator	28257739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16740736		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28423600, 30577494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28423600, 30630828, 35189148, 35999349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	15496935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mirror movements disorder	Mirror Movements	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30572643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	11032376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy	Muscular dystrophy	BEFREE	30289454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21387288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12759238, 15159408, 15824892, 15832194, 16367914, 19608870, 20097731, 20413845, 20638106, 21387288, 21499306, 21680106, 22271687, 22535643, 25344212 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30552945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28475917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	30936125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20097731, 21680106, 22277373, 25344212, 27113098, 28231233, 29578153, 31027181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	15832194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Normosmic congenital hypogonadotropic hypogonadism	Normosmic Congenital Hypogonadotropic Hypogonadism	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16126724, 28866049, 28873424, 29062272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35188450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18632752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12759238, 15084966, 15824892, 15832194, 19896096, 23063941, 9858808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15824892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12759238, 15832194, 18694935, 20638106, 36017891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22535643, 23132790, 23544999, 25499223, 28910386, 29209896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25241655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28876465, 37681336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	22848708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	22848708	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22155192		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	30572643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary physiologic amenorrhea	Secondary Physiologic Amenorrhea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29493888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21680106, 29578153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21387288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23870818, 29578153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24716913, 29050982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24716913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29050982	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28350009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular hypogonadism	Testicular Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25499223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24222120, 28910386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24222120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25201346, 34970732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31238530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	15832194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DUSP6 (dual specificity phosphatase 6)