DUSP15 (dual specificity phosphatase 15)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 128853
• Gene name: Dual specificity phosphatase 15
• Gene symbol: DUSP15
• Synonyms (NCBI Gene): C20orf57, VHY
• Chromosome: 20
• Chromosome location: 20q11.21
• Summary: The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocyt

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT947452	hsa-miR-1538	CLIP-seq
MIRT947453	hsa-miR-214	CLIP-seq
MIRT947454	hsa-miR-3619-5p	CLIP-seq
MIRT947455	hsa-miR-3687	CLIP-seq
MIRT947456	hsa-miR-4442	CLIP-seq
MIRT947457	hsa-miR-4690-5p	CLIP-seq
MIRT947458	hsa-miR-4745-3p	CLIP-seq
MIRT947459	hsa-miR-761	CLIP-seq
MIRT1556251	hsa-miR-361-3p	CLIP-seq
MIRT1556252	hsa-miR-3648	CLIP-seq
MIRT1556253	hsa-miR-4283	CLIP-seq
MIRT1556254	hsa-miR-4508	CLIP-seq
MIRT1556255	hsa-miR-744	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	22792334
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	17474147
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	17498703
GO:0016020	Component	Membrane	IEA
GO:0016311	Process	Dephosphorylation	IDA	24531476
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IDA	24531476
GO:0048713	Process	Regulation of oligodendrocyte differentiation	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA

Other IDs

• MIM: 616776
• HGNC: 16236
• e!Ensembl: ENSG00000149599

Protein

• UniProt ID: Q9H1R2
• Protein name: Dual specificity protein phosphatase 15 (EC 3.1.3.16) (EC 3.1.3.48) (VH1-related member Y) (Vaccinia virus VH1-related dual-specific protein phosphatase Y)
• Protein function: May dephosphorylate MAPK13, ATF2, ERBB3, PDGFRB and SNX6 (PubMed:22792334). ; [Isoform 3]: May play a role in the regulation of oligodendrocyte differentiation. May play a role in the regulation of myelin
• PDB: 1YZ4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00782	DSPc	9 → 137	Dual specificity phosphatase, catalytic domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis (PubMed:15138252). Expressed in brain; up-regulated in patients with multiple sclerosis gray matter lesions (PubMed:22792334). {ECO:0000269|PubMed:15138252, ECO:0000269|PubMed:22792334}.
• Sequence:

  MTEGVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPI
  KKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRP
  IANPNPGFRQQLEEFGWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVRE
  ATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTQHPKEQLIM
  ADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRAASSSCTR

• Sequence length: 295

Related Genes

No strongly related genes found yet for DUSP15.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DUSP15.