DSCR8 (Down syndrome critical region 8)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 84677 |
| Gene name | Down syndrome critical region 8 |
| Gene symbol | DSCR8 |
| Synonyms (NCBI Gene) |
C21orf65CT25.1aCT25.1bMMA-1MMA-1aMMA-1bMMA1MTAG2
|
| Chromosome | 21 |
| Chromosome location | 21q22.13 |
|
miRNA
miRNA information provided by mirtarbase database.
2
|
|||||||||||||
|
|||||||||||||
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q96T75 |
| Protein name | Down syndrome critical region protein 8 (Cancer/testis antigen 25) (CT25) (DCR1-24.0) (Malignant melanoma-associated protein 1) (MMA-1) (Protein MTAG2) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in numerous tissues; not found in breast, heart, small intestine and liver (PubMed:12036297). Isoform 1: Predominantly expressed in the testis (PubMed:11920614, PubMed:15472897). Isoform 3: Predominantly expressed in the test |
| Sequence |
MKEPGPNFVTVRKGLHSFKMAFVKHLLLFLSPRLECSGSITDHCSLHLPVQEILMSQPPE |
| Sequence length | 97 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with DSCR8 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to DSCR8 (see Related Genes above), that are NOT already directly curated for DSCR8 itself -- a lead worth checking, not a confirmed association.
0
|
|