DSCR4 (Down syndrome critical region 4) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10281
Gene name	Down syndrome critical region 4
Gene symbol	DSCR4
Synonyms (NCBI Gene)	DCRBDSCRB
Chromosome	21
Chromosome location	21q22.13
Summary	The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus. [provided by RefSeq, Jan 2015]

9 Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT945810	hsa-miR-1253	CLIP-seq
MIRT945811	hsa-miR-1324	CLIP-seq
MIRT945812	hsa-miR-140-3p	CLIP-seq
MIRT945813	hsa-miR-3129-3p	CLIP-seq
MIRT945814	hsa-miR-411	CLIP-seq
MIRT945815	hsa-miR-4251	CLIP-seq
MIRT945816	hsa-miR-4731-3p	CLIP-seq
MIRT945817	hsa-miR-4797-5p	CLIP-seq
MIRT945818	hsa-miR-4801	CLIP-seq

3

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005575	Component	Cellular_component	ND
GO:0008150	Process	Biological_process	ND

MIM	HGNC	e!Ensembl
604829	3045	ENSG00000184029

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	P56555
Protein name	Down syndrome critical region protein 4 (Down syndrome critical region protein B)
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Mainly expressed in placenta.
Sequence	MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSF SLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST
Sequence length	118
Interactions	View interactions