DRC12 (dynein regulatory complex subunit 12 homolog)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283152
Gene name Dynein regulatory complex subunit 12 homolog
Gene symbol DRC12
Synonyms (NCBI Gene)
CCDC153
Chromosome 11
Chromosome location 11q23.3
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT643074 hsa-miR-4461 HITS-CLIP 23824327
MIRT643073 hsa-miR-3677-5p HITS-CLIP 23824327
MIRT643074 hsa-miR-4461 HITS-CLIP 23824327
MIRT643073 hsa-miR-3677-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 29892012, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005929 Component Cilium IEA
GO:0031514 Component Motile cilium IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q494R4
Protein name Dynein regulatory complex protein 12 (Coiled-coil domain-containing protein 153) (Dynein regulatory complex subunit 12 homolog)
Protein function Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. {ECO:0000250|UniProtK
Family and domains
Sequence 
MPPKNKEKGKKSGAQKKKKNWGADVVAESRHRLVVLEKELLRDHLALRRDEARRAKASED
QLRQRLQGVEAELEGARSEGKAIYAEMSRQCHALQEDMQTRSKQLEEEVKGLRGQLEACQ
REAAAAREEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGA
ALRLHARHKEQQRQFGLTPPGSLRPPAPSL
Sequence length 210
Interactions View interactions

No strongly related genes found yet for DRC12.

No additional diseases found yet through genes similar to DRC12.