Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Entrez ID 1806
Gene name Dihydropyrimidine dehydrogenase
Gene symbol DPYD
Synonyms (NCBI Gene)
DHPDHPDHASEDPDDYPD
Chromosome 1
Chromosome location 1p21.3
Summary The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidi
SNPs SNP information provided by dbSNP.
50 Show/Hide all (50)
SNP ID Visualize variation Clinical significance Consequence
rs1801158 C>T Benign, conflicting-interpretations-of-pathogenicity Intron variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1801265 A>G Pathogenic, benign, not-provided Intron variant, missense variant, coding sequence variant, non coding transcript variant, 5 prime UTR variant
rs1801266 G>A Drug-response, uncertain-significance Genic downstream transcript variant, coding sequence variant, missense variant
rs1801268 C>A Drug-response Genic downstream transcript variant, coding sequence variant, missense variant
rs3918290 C>G,T Pathogenic, drug-response, uncertain-significance, conflicting-interpretations-of-pathogenicity Splice donor variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
30 Show/Hide all (30)
miRTarBase ID miRNA Experiments Reference
MIRT022744 hsa-miR-124-3p Microarray 18668037
MIRT437994 hsa-miR-27a-3p Luciferase reporter assay 24401318
MIRT437993 hsa-miR-27b-3p Luciferase reporter assay 24401318
MIRT437993 hsa-miR-27b-3p Luciferase reporter assay 24401318
MIRT437994 hsa-miR-27a-3p Luciferase reporter assay 24401318
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39 Show/Hide all (39)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0002058 Function Uracil binding IBA
GO:0005515 Function Protein binding IPI 25416956
GO:0005737 Component Cytoplasm IDA 1512248
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612779 3012 ENSG00000188641
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q12882
Protein name Dihydropyrimidine dehydrogenase [NADP(+)] (DHPDHase) (DPD) (EC 1.3.1.2) (Dihydrothymine dehydrogenase) (Dihydrouracil dehydrogenase)
Protein function Involved in pyrimidine base degradation (PubMed:1512248). Catalyzes the reduction of uracil and thymine (PubMed:1512248). Also involved the degradation of the chemotherapeutic drug 5-fluorouracil (PubMed:1512248).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01180 DHO_dh 532 → 838 Dihydroorotate dehydrogenase Domain
PF07992 Pyr_redox_2 187 → 499 Pyridine nucleotide-disulphide oxidoreductase Domain
PF14691 Fer4_20 55 → 168 Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster Domain
PF14697 Fer4_21 946 → 1004 Domain
Tissue specificity TISSUE SPECIFICITY: Found in most tissues with greatest activity found in liver and peripheral blood mononuclear cells.
Sequence
MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFD
DIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDN
PLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSI
PQIRNPSLPPPE
KMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDV
VNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAIFQGLTQD
QGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRVF
IVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGG
DVVGLANTTVESVNDGKQA
SWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGL
KFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMY
GPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNIVIASIMCSYNKNDWTELAKKSEDS
GADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSI
ARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTS
IARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALL
YL
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQ
NVAFSPLKRNCFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCY
MTCNDSGYQAIQFDPETHLPTITDTCTGCTLCLSVCPIVDCIKM
VSRTTPYEPKRGVPLS
VNPVC
Sequence length 1025
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
KEGG Pathway Reactome Pathway
Pyrimidine metabolism Pyrimidine catabolism
beta-Alanine metabolism  
Pantothenate and CoA biosynthesis  
Drug metabolism - other enzymes  
Metabolic pathways  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
68
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
5-fluorouracil response Likely pathogenic rs755416212 RCV003332223
★★★★★
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dihydropyrimidine dehydrogenase deficiency Likely pathogenic; Pathogenic rs568132506, rs769925158, rs1669337684, rs2101026231, rs2102259303, rs778614771, rs2524094344, rs773499329, rs72549310, rs772950053, rs2100972370, rs372307932, rs1057516713, rs2524373926, rs72549304
View all (117 more)
RCV001329029
RCV002308674
RCV001335115
RCV001553731
RCV003470927
View all (129 more)
★★★★★
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
DPYD-related disorder Likely pathogenic; Pathogenic rs1057516713, rs2524373926, rs1057516968 RCV003391615
RCV003427915
RCV003409565
★★★★★
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fluorouracil response Pathogenic rs72547602 RCV000030869
★★★★★
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (63)
Phenotype Name Clinical Significance Source Reference Evidence Score
1P21.3 MICRODELETION SYNDROME — Disgenet, Orphanet
Disgenet, Orphanet
21114665, 22003227
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia drug response ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary drug response ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANAL POLYP — GWAS catalog 40465716
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (234)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
1p21.3 microdeletion syndrome 1p21.3 microdeletion syndrome Orphanet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 26846104, 28618970
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 15868929, 19015148, 21062732, 24405586, 26031756, 28835573
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 16969493
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon BEFREE 20387074
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 19015148, 24405586, 25573239
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of rectum Adenocarcinoma Of Rectum BEFREE 17688376
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyloidosis Amyloidosis BEFREE 21679902, 22464102, 23231421, 24939945, 27645889, 28159995, 29687207, 31019172
★★★★★
★☆☆☆☆
Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED Amyloidosis BEFREE 31019172
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 23991104
★★★★★
★☆☆☆☆
Found in Text Mining only