DPPA4 (developmental pluripotency associated 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55211
• Gene name: Developmental pluripotency associated 4
• Gene symbol: DPPA4
• Synonyms (NCBI Gene): 2410091M23Rik
• Chromosome: 3
• Chromosome location: 3q13.13
• Summary: This gene encodes a nuclear factor that is involved in the maintenance of pluripotency in stem cells and essential for embryogenesis. The encoded protein has a scaffold-attachment factor A/B, acinus and PIAS (SAP) domain that binds DNA and is thought to m

miRNA Show/Hide all (97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029606	hsa-miR-26b-5p	Microarray	19088304
MIRT944369	hsa-miR-1285	CLIP-seq
MIRT944370	hsa-miR-1827	CLIP-seq
MIRT944371	hsa-miR-3125	CLIP-seq
MIRT944372	hsa-miR-3143	CLIP-seq
MIRT944373	hsa-miR-3187-5p	CLIP-seq
MIRT944374	hsa-miR-3916	CLIP-seq
MIRT944375	hsa-miR-3941	CLIP-seq
MIRT944376	hsa-miR-4255	CLIP-seq
MIRT944377	hsa-miR-4257	CLIP-seq
MIRT944378	hsa-miR-4287	CLIP-seq
MIRT944379	hsa-miR-4302	CLIP-seq
MIRT944380	hsa-miR-466	CLIP-seq
MIRT944381	hsa-miR-4672	CLIP-seq
MIRT944382	hsa-miR-4685-3p	CLIP-seq
MIRT944383	hsa-miR-4691-5p	CLIP-seq
MIRT944384	hsa-miR-4697-3p	CLIP-seq
MIRT944385	hsa-miR-4709-5p	CLIP-seq
MIRT944386	hsa-miR-4722-5p	CLIP-seq
MIRT944387	hsa-miR-4731-3p	CLIP-seq
MIRT944388	hsa-miR-4768-3p	CLIP-seq
MIRT944389	hsa-miR-4780	CLIP-seq
MIRT944390	hsa-miR-4801	CLIP-seq
MIRT944391	hsa-miR-486-5p	CLIP-seq
MIRT944392	hsa-miR-508-5p	CLIP-seq
MIRT944393	hsa-miR-543	CLIP-seq
MIRT944394	hsa-miR-550a	CLIP-seq
MIRT944395	hsa-miR-579	CLIP-seq
MIRT944396	hsa-miR-612	CLIP-seq
MIRT944397	hsa-miR-623	CLIP-seq
MIRT944398	hsa-miR-661	CLIP-seq
MIRT944399	hsa-miR-665	CLIP-seq
MIRT944400	hsa-miR-764	CLIP-seq
MIRT944401	hsa-miR-766	CLIP-seq
MIRT944402	hsa-miR-940	CLIP-seq
MIRT944369	hsa-miR-1285	CLIP-seq
MIRT1979627	hsa-miR-3149	CLIP-seq
MIRT944373	hsa-miR-3187-5p	CLIP-seq
MIRT944385	hsa-miR-4709-5p	CLIP-seq
MIRT1979628	hsa-miR-4793-3p	CLIP-seq
MIRT944392	hsa-miR-508-5p	CLIP-seq
MIRT944396	hsa-miR-612	CLIP-seq
MIRT944398	hsa-miR-661	CLIP-seq
MIRT944399	hsa-miR-665	CLIP-seq
MIRT944401	hsa-miR-766	CLIP-seq
MIRT944369	hsa-miR-1285	CLIP-seq
MIRT2214688	hsa-miR-15a	CLIP-seq
MIRT2214689	hsa-miR-15b	CLIP-seq
MIRT2214690	hsa-miR-16	CLIP-seq
MIRT2214691	hsa-miR-195	CLIP-seq
MIRT2214692	hsa-miR-214	CLIP-seq
MIRT2214693	hsa-miR-25	CLIP-seq
MIRT2214694	hsa-miR-3065-3p	CLIP-seq
MIRT2214695	hsa-miR-3065-5p	CLIP-seq
MIRT944373	hsa-miR-3187-5p	CLIP-seq
MIRT2214696	hsa-miR-32	CLIP-seq
MIRT2214697	hsa-miR-3619-5p	CLIP-seq
MIRT2214698	hsa-miR-3622a-3p	CLIP-seq
MIRT2214699	hsa-miR-3622b-3p	CLIP-seq
MIRT2214700	hsa-miR-363	CLIP-seq
MIRT2214701	hsa-miR-367	CLIP-seq
MIRT2214702	hsa-miR-3977	CLIP-seq
MIRT2214703	hsa-miR-424	CLIP-seq
MIRT2214704	hsa-miR-4291	CLIP-seq
MIRT2214705	hsa-miR-4459	CLIP-seq
MIRT2214706	hsa-miR-4695-5p	CLIP-seq
MIRT944385	hsa-miR-4709-5p	CLIP-seq
MIRT1979628	hsa-miR-4793-3p	CLIP-seq
MIRT2214707	hsa-miR-495	CLIP-seq
MIRT2214708	hsa-miR-497	CLIP-seq
MIRT944392	hsa-miR-508-5p	CLIP-seq
MIRT2214709	hsa-miR-513c	CLIP-seq
MIRT2214710	hsa-miR-514b-5p	CLIP-seq
MIRT944395	hsa-miR-579	CLIP-seq
MIRT944396	hsa-miR-612	CLIP-seq
MIRT944398	hsa-miR-661	CLIP-seq
MIRT944399	hsa-miR-665	CLIP-seq
MIRT2214711	hsa-miR-761	CLIP-seq
MIRT944401	hsa-miR-766	CLIP-seq
MIRT2214712	hsa-miR-767-5p	CLIP-seq
MIRT2214713	hsa-miR-922	CLIP-seq
MIRT2214714	hsa-miR-92a	CLIP-seq
MIRT2214715	hsa-miR-92b	CLIP-seq
MIRT944400	hsa-miR-764	CLIP-seq
MIRT2519154	hsa-miR-2114	CLIP-seq
MIRT2519155	hsa-miR-3122	CLIP-seq
MIRT2519156	hsa-miR-338-3p	CLIP-seq
MIRT2519157	hsa-miR-3689a-3p	CLIP-seq
MIRT2519158	hsa-miR-3689c	CLIP-seq
MIRT2519159	hsa-miR-3913-5p	CLIP-seq
MIRT2519160	hsa-miR-4310	CLIP-seq
MIRT2519161	hsa-miR-4641	CLIP-seq
MIRT2519162	hsa-miR-4728-5p	CLIP-seq
MIRT944400	hsa-miR-764	CLIP-seq
MIRT2679455	hsa-miR-4786-5p	CLIP-seq
MIRT944400	hsa-miR-764	CLIP-seq
MIRT2679456	hsa-miR-769-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 16189514, 21516116, 21900206, 25416956, 26687479, 26871637, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0048731	Process	System development	IBA
GO:0060484	Process	Lung-associated mesenchyme development	IEA

Other IDs

• MIM: 614125
• HGNC: 19200
• e!Ensembl: ENSG00000121570

Protein

• UniProt ID: Q7L190
• Protein name: Developmental pluripotency-associated protein 4
• Protein function: May be involved in the maintenance of active epigenetic status of target genes. May inhibit differentiation of embryonic cells into a primitive ectoderm lineage.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14047	DCR	227 → 294	Dppa2/4 conserved region	Family
  PF14049	Dppa2_A	179 → 228	Dppa2/4 conserved region in higher vertebrates	Family
  PF14049	Dppa2_A	129 → 167	Dppa2/4 conserved region in higher vertebrates	Family

• Sequence:

  MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKV
  LCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRDILRAWCQQLKLSSKGQKLDAYKR
  LCAFAYPNQKDFPSTAKEAKIRKSLQKKLKVEKGETSLQSSETHPPEVALPPVGEPPALE
  NSTALLEGVNTVVVTTSAPEALLASWARISARARTPEAVESPQEASGVRWCVVHGKSLPA
  DTDGWVHLQFHAGQAWVPEKQEGRVSALFLLPASNFPPPHLEDNMLCPKCVHRNKVLIKS
  LQWE

• Sequence length: 304

Pathways

Reactome Pathway:

POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (11)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colon Carcinoma	Colon Carcinoma	BEFREE	26063247		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26063247		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26063247	Stimulate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36581877	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30031967		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26063247		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31180527		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31180527		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16306258		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	16306258	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26436875		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for DPPA4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DPPA4.