DPH3P1 (diphthamide biosynthesis 3 pseudogene 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 100132911
• Gene name: Diphthamide biosynthesis 3 pseudogene 1
• Gene symbol: DPH3P1
• Synonyms (NCBI Gene): C20orf143, DPH3B, ZCSL1
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: This gene may represent a processed pseudogene of DPH3, GeneID: 285381, because it lacks the exon/intron structure found in the functional gene. It does contain an intact open reading frame but it has not been established that the predicted protein is tra

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT944028	hsa-miR-1200	CLIP-seq
MIRT944029	hsa-miR-2115	CLIP-seq
MIRT944030	hsa-miR-214	CLIP-seq
MIRT944031	hsa-miR-3140-5p	CLIP-seq
MIRT944032	hsa-miR-3619-5p	CLIP-seq
MIRT944033	hsa-miR-3977	CLIP-seq
MIRT944034	hsa-miR-4291	CLIP-seq
MIRT944035	hsa-miR-4699-5p	CLIP-seq
MIRT944036	hsa-miR-516a-3p	CLIP-seq
MIRT944037	hsa-miR-761	CLIP-seq
MIRT944038	hsa-miR-922	CLIP-seq
MIRT944029	hsa-miR-2115	CLIP-seq
MIRT1979532	hsa-miR-4263	CLIP-seq
MIRT1979533	hsa-miR-4477b	CLIP-seq
MIRT1979534	hsa-miR-508-5p	CLIP-seq
MIRT944036	hsa-miR-516a-3p	CLIP-seq
MIRT1979535	hsa-miR-598	CLIP-seq
MIRT2214624	hsa-miR-186	CLIP-seq
MIRT944029	hsa-miR-2115	CLIP-seq
MIRT944030	hsa-miR-214	CLIP-seq
MIRT2214625	hsa-miR-3134	CLIP-seq
MIRT944032	hsa-miR-3619-5p	CLIP-seq
MIRT2214626	hsa-miR-3688-3p	CLIP-seq
MIRT2214627	hsa-miR-3978	CLIP-seq
MIRT944034	hsa-miR-4291	CLIP-seq
MIRT2214628	hsa-miR-4534	CLIP-seq
MIRT944036	hsa-miR-516a-3p	CLIP-seq
MIRT944037	hsa-miR-761	CLIP-seq
MIRT944038	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0017183	Process	Protein histidyl modification to diphthamide	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: HGNC
• HGNC: 16136
• e!Ensembl: N/A

Protein

• UniProt ID: Q9H4G8
• Protein name: Putative DPH3 homolog B (CSL-type zinc finger-containing protein 1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05207	zf-CSL	6 → 60	CSL zinc finger	Domain

• Sequence:

  MAVFHDEVEIEDFQYDEDSETYFCPCPCGDNFSITKEELENGEGVAMCPGCSLIIKVIYD
  KDQFACGETVPVPSVNKE

• Sequence length: 78

Related Genes

No strongly related genes found yet for DPH3P1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DPH3P1.