Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	79930
Gene name	Docking protein 3
Gene symbol	DOK3
Synonyms (NCBI Gene)	DOKL
Chromosome	5
Chromosome location	5q35.3

48 Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044507	hsa-miR-320a	CLASH	23622248
MIRT044507	hsa-miR-320a	CLASH	23622248
MIRT943095	hsa-miR-3202	CLIP-seq
MIRT943096	hsa-miR-3925-5p	CLIP-seq
MIRT943097	hsa-miR-4271	CLIP-seq
MIRT943098	hsa-miR-4475	CLIP-seq
MIRT943099	hsa-miR-4716-3p	CLIP-seq
MIRT943100	hsa-miR-4725-3p	CLIP-seq
MIRT943101	hsa-miR-4747-5p	CLIP-seq
MIRT943102	hsa-miR-4773	CLIP-seq
MIRT943103	hsa-miR-625	CLIP-seq
MIRT943104	hsa-miR-3134	CLIP-seq
MIRT943105	hsa-miR-3185	CLIP-seq
MIRT943106	hsa-miR-4476	CLIP-seq
MIRT943107	hsa-miR-3130-3p	CLIP-seq
MIRT943108	hsa-miR-433	CLIP-seq
MIRT943109	hsa-miR-4677-3p	CLIP-seq
MIRT943110	hsa-miR-4679	CLIP-seq
MIRT943111	hsa-miR-4793-3p	CLIP-seq
MIRT943112	hsa-miR-627	CLIP-seq
MIRT943113	hsa-miR-664	CLIP-seq
MIRT943114	hsa-miR-924	CLIP-seq
MIRT1979249	hsa-miR-3144-5p	CLIP-seq
MIRT1979250	hsa-miR-3191	CLIP-seq
MIRT1979251	hsa-miR-4652-5p	CLIP-seq
MIRT2214402	hsa-miR-3194-3p	CLIP-seq
MIRT2214403	hsa-miR-3921	CLIP-seq
MIRT2214404	hsa-miR-4303	CLIP-seq
MIRT2214405	hsa-miR-4653-5p	CLIP-seq
MIRT943109	hsa-miR-4677-3p	CLIP-seq
MIRT943110	hsa-miR-4679	CLIP-seq
MIRT2214406	hsa-miR-4795-3p	CLIP-seq
MIRT2387072	hsa-miR-1183	CLIP-seq
MIRT2387073	hsa-miR-3125	CLIP-seq
MIRT943105	hsa-miR-3185	CLIP-seq
MIRT2387074	hsa-miR-3916	CLIP-seq
MIRT2387075	hsa-miR-3919	CLIP-seq
MIRT2387076	hsa-miR-3928	CLIP-seq
MIRT2387077	hsa-miR-4257	CLIP-seq
MIRT943106	hsa-miR-4476	CLIP-seq
MIRT2387078	hsa-miR-4709-3p	CLIP-seq
MIRT2448475	hsa-miR-1294	CLIP-seq
MIRT2448476	hsa-miR-2355-5p	CLIP-seq
MIRT2448477	hsa-miR-3679-3p	CLIP-seq
MIRT2448478	hsa-miR-4316	CLIP-seq
MIRT2448479	hsa-miR-4633-5p	CLIP-seq
MIRT943109	hsa-miR-4677-3p	CLIP-seq
MIRT2448480	hsa-miR-532-5p	CLIP-seq

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17290227, 25416956, 25814554, 27956147, 31515488, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

MIM	HGNC	e!Ensembl
611435	24583	ENSG00000146094

Q7L591

Protein name

Docking protein 3 (Downstream of tyrosine kinase 3)

Protein function

DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK3 is a negative regulator of JNK signaling in B-cells through interaction with INPP5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02174	IRS	213 → 312	PTB domain (IRS-1 type)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in spleen. {ECO:0000269|PubMed:12595900}.

Sequence

MTRGARLRSDARAQLNQLSLDGGTGSGQKGKCEEFPSSLSSVSPGLEAAALLLAVTMDPL
ETPIKDGILYQQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRDGGLGAAGDRSAGPG
RRGERRVIRLADCVSVLPADGESCPRDTGAFLLTTTERSHLLAAQHRQAWMGPICQLAFP
GTGEASSGSTDAQSPKRGLVPMEENSIYSSWQEVGEFPVVVQRTEAATRCQLKGPALLVL
GPDAIQLREAKGTQALYSWPYHFLRKFGSDKGVFSFEAGRRCHSGEGLFAFSTPCAPDLC
RAVAGAIARQRERLPELTRPQPCPLPRATSLPSLDTPGELREMPPGPEPPTSRKMHLAEP
GPQSLPLLLGPEPNDLASGLYASVCKRASGPPGNEHLYENLCVLEASPTLHGGEPEPHEG
PGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVT
LLSRERRKGPAPCDRP

Sequence length

496

Interactions

View interactions

Reactome Pathway
Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	20139980	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34872567, 37235715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27354594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20970032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	20139980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	20139980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	36028467	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37235715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	20139980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29548825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28590889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36210538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with DOK3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for DOK3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to DOK3 (see Related Genes above), that are NOT already directly curated for DOK3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to DOK3.

DOK3 (docking protein 3)

Save This Analysis