DOC2B (double C2 domain beta)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 8447
• Gene name: Double C2 domain beta
• Gene symbol: DOC2B
• Synonyms (NCBI Gene): DOC2BL
• Chromosome: 17
• Chromosome location: 17p13.3
• Summary: There are at least two protein isoforms of the Double C2 protein, namely alpha (DOC2A) and beta (DOC2B), which contain two C2-like domains. DOC2A and DOC2B are encoded by different genes; these genes are at times confused with the unrelated DAB2 gene wh

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008104	Process	Intracellular protein localization	ISS
GO:0016020	Component	Membrane	IEA
GO:0019905	Function	Syntaxin binding	IEA
GO:0031201	Component	SNARE complex	ISS
GO:0031340	Process	Positive regulation of vesicle fusion	ISS
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0045202	Component	Synapse	IBA
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	IBA
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048791	Process	Calcium ion-regulated exocytosis of neurotransmitter	IEA
GO:0048791	Process	Calcium ion-regulated exocytosis of neurotransmitter	ISS
GO:0061669	Process	Spontaneous neurotransmitter secretion	IEA
GO:0098793	Component	Presynapse	IEA
GO:0099502	Process	Calcium-dependent activation of synaptic vesicle fusion	IBA
GO:0099502	Process	Calcium-dependent activation of synaptic vesicle fusion	IEA

Other IDs

• MIM: 604568
• HGNC: 2986
• e!Ensembl: ENSG00000272636

Protein

• UniProt ID: Q14184
• Protein name: Double C2-like domain-containing protein beta (Doc2-beta)
• Protein function: Calcium sensor which positively regulates SNARE-dependent fusion of vesicles with membranes. Binds phospholipids in a calcium-dependent manner and may act at the priming stage of fusion by modifying membrane curvature to stimulate fusion. Involv
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	141 → 250	C2 domain	Domain
  PF00168	C2	281 → 387	C2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in brain and kidney. Expressed in pancreatic islet cells (at protein level). {ECO:0000269|PubMed:17548353, ECO:0000269|PubMed:8554557}.
• Sequence:

  MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPPDAPA
  RPAVAGAGRRSPSDGAREDDEDVDQLFGAYGSSPGPSPGPSPARPPAKPPEDEPDADGYE
  SDDCTALGTLDFSLLYDQENNALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKL
  RTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKLKP
  NHTKTFSICLEKQLPVDKTEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANG
  YSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVWDYDI
  GKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSELPGAVLSD

• Sequence length: 412

Related Genes

No strongly related genes found yet for DOC2B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DOC2B.