Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	116092
Gene name	Deoxynucleotidyltransferase terminal interacting protein 1
Gene symbol	DNTTIP1
Synonyms (NCBI Gene)	C20orf167Tdif1dJ447F3.4
Chromosome	20
Chromosome location	20q13.12
Summary	DNTTIP1 binds DNA and enhances the activity of terminal deoxynucleotidyltransferase (TDT, or DNTT; MIM 187410), a DNA polymerase that catalyzes the polymerization of DNA in the absence of a DNA template (Yamashita et al., 2001 [PubMed 11473582]).[supplied

15 Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036798	hsa-miR-760	CLASH	23622248
MIRT942711	hsa-miR-1283	CLIP-seq
MIRT942712	hsa-miR-3146	CLIP-seq
MIRT942713	hsa-miR-452	CLIP-seq
MIRT942714	hsa-miR-4676-3p	CLIP-seq
MIRT942715	hsa-miR-4733-5p	CLIP-seq
MIRT942716	hsa-miR-520d-5p	CLIP-seq
MIRT942717	hsa-miR-524-5p	CLIP-seq
MIRT942718	hsa-miR-548g	CLIP-seq
MIRT2214262	hsa-miR-155	CLIP-seq
MIRT2214263	hsa-miR-365	CLIP-seq
MIRT2214264	hsa-miR-4269	CLIP-seq
MIRT2214265	hsa-miR-4514	CLIP-seq
MIRT2214266	hsa-miR-4692	CLIP-seq
MIRT2214267	hsa-miR-4742-5p	CLIP-seq

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	25653165
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IDA	11473582, 25653165
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11473582, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11473582, 16371131
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0031491	Function	Nucleosome binding	IBA
GO:0031491	Function	Nucleosome binding	IDA	25653165
GO:0042803	Function	Protein homodimerization activity	IDA	11473582

MIM	HGNC	e!Ensembl
611388	16160	ENSG00000101457

Q9H147

Protein name

Deoxynucleotidyltransferase terminal-interacting protein 1 (Terminal deoxynucleotidyltransferase-interacting factor 1) (TdIF1) (TdT-interacting factor 1)

Protein function

Increases DNTT terminal deoxynucleotidyltransferase activity (in vitro) (PubMed:11473582). Also acts as a transcriptional regulator, binding to the consensus sequence 5'-GNTGCATG-3' following an AT-tract. Associates with RAB20 promoter and posit

PDB

2MWI , 4D6K , 6Z2J , 6Z2K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18192	DNTTIP1_dimer	65 → 132	DNTTIP1 dimerisation domain	Domain

Sequence

MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSF
TDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRS
CLEQAKLLFSDGEKVIPRLTHELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDR
AAAGMVWKPKSCEPIRREGPKWDPARLNESTTFVLGSRANKALGMGGTRGRIYIKHPHLF
KYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAASDDYRGCLDLKLEELKSFVLP
SWMVEKMRKYMETLRTENEHRAVEAPPQT

Sequence length

329

Interactions

View interactions

Related Genes Genes most often co-reported with DNTTIP1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for DNTTIP1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to DNTTIP1 (see Related Genes above), that are NOT already directly curated for DNTTIP1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to DNTTIP1.

DNTTIP1 (deoxynucleotidyltransferase terminal interacting protein 1)

Bookmark This Gene