DNTT (DNA nucleotidylexotransferase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1791
• Gene name: DNA nucleotidylexotransferase
• Gene symbol: DNTT
• Synonyms (NCBI Gene): TDT
• Chromosome: 10
• Chromosome location: 10q24.1
• Summary: This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3`-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed i

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000791	Component	Euchromatin	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003887	Function	DNA-directed DNA polymerase activity	IEA
GO:0003912	Function	DNA nucleotidylexotransferase activity	IBA
GO:0003912	Function	DNA nucleotidylexotransferase activity	IDA	11473582
GO:0003912	Function	DNA nucleotidylexotransferase activity	IEA
GO:0003912	Function	DNA nucleotidylexotransferase activity	TAS	2863268
GO:0005515	Function	Protein binding	IPI	11473582, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16371131
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006259	Process	DNA metabolic process	IDA	11473582
GO:0006259	Process	DNA metabolic process	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IBA
GO:0006304	Process	DNA modification	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0034061	Function	DNA polymerase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071897	Process	DNA biosynthetic process	IEA

Other IDs

• MIM: 187410
• HGNC: 2983
• e!Ensembl: ENSG00000107447

Protein

• UniProt ID: P04053
• Protein name: DNA nucleotidylexotransferase (EC 2.7.7.31) (Terminal addition enzyme) (Terminal deoxynucleotidyltransferase) (Terminal transferase)
• Protein function: Template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of
• PDB: 2COE , 5W4E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00533	BRCT	27 → 111	BRCA1 C Terminus (BRCT) domain	Family
  PF01909	NTP_transf_2	312 → 403	Nucleotidyltransferase domain	Family
  PF10391	DNA_pol_lambd_f	250 → 300	Fingers domain of DNA polymerase lambda	Domain
  PF14716	HHH_8	165 → 230	Helix-hairpin-helix domain	Domain
  PF14791	DNA_pol_B_thumb	445 → 508	DNA polymerase beta thumb	Family

• Sequence:

  MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG
  FRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMT
  GKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE
  FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAV
  LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV
  SCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQL
  LQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS
  WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKT
  KRIFLKAESEEEIFAHLGLDYIEPWERNA

• Sequence length: 509

Pathways

KEGG Pathway

Non-homologous end-joining

Hematopoietic cell lineage

Related Genes

No strongly related genes found yet for DNTT.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DNTT.