DNPH1 (2'-deoxynucleoside 5'-phosphate N-hydrolase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10591
• Gene name: 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
• Gene symbol: DNPH1
• Synonyms (NCBI Gene): C6orf108, RCL, dJ330M21.3
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but stu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT049552	hsa-miR-92a-3p	CLASH	23622248

Gene ontology (GO) Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000255	Process	Allantoin metabolic process	IEA
GO:0005515	Function	Protein binding	IPI	21044950, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9271375
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IDA	18726892
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006195	Process	Purine nucleotide catabolic process	IEA
GO:0006195	Process	Purine nucleotide catabolic process	TAS
GO:0009116	Process	Nucleoside metabolic process	IEA
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0009159	Process	Deoxyribonucleoside monophosphate catabolic process	IBA
GO:0009159	Process	Deoxyribonucleoside monophosphate catabolic process	IDA	25108359
GO:0009159	Process	Deoxyribonucleoside monophosphate catabolic process	IEA
GO:0009159	Process	Deoxyribonucleoside monophosphate catabolic process	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016799	Function	Hydrolase activity, hydrolyzing N-glycosyl compounds	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030307	Process	Positive regulation of cell growth	ISS
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043174	Process	Nucleoside salvage	IMP	33833118
GO:0046055	Process	DGMP catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070694	Function	5-hydroxymethyl-dUMP N-hydrolase activity	IBA
GO:0070694	Function	5-hydroxymethyl-dUMP N-hydrolase activity	IDA	25108359, 33833118, 37142196
GO:0070694	Function	5-hydroxymethyl-dUMP N-hydrolase activity	IEA
GO:0070694	Function	5-hydroxymethyl-dUMP N-hydrolase activity	ISS
GO:0070694	Function	5-hydroxymethyl-dUMP N-hydrolase activity	TAS
GO:1901135	Process	Carbohydrate derivative metabolic process	IEA

Other IDs

• MIM: 618762
• HGNC: 21218
• e!Ensembl: ENSG00000112667

Protein

• UniProt ID: O43598
• Protein name: 5-hydroxymethyl-dUMP N-hydrolase (EC 3.2.2.-) (2'-deoxynucleoside 5'-phosphate N-hydrolase 1) (c-Myc-responsive protein RCL)
• Protein function: Part of a nucleotide salvage pathway that eliminates epigenetically modified 5-hydroxymethyl-dCMP (hmdCMP) in a two-step process entailing deamination to cytotoxic 5-hydroxymethyl-dUMP (hmdUMP), followed by its hydrolysis into 5-hydroxymethylura
• PDB: 4P5E , 8OS9 , 8OSC , 8QHQ , 8QHR , 8RPS , 8RPT , 8RQD , 9DA1 , 9DA2 , 9DA3 , 9DA4 , 9DA5 , 9DA6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05014	Nuc_deoxyrib_tr	23 → 149	Nucleoside 2-deoxyribosyltransferase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low levels in brain, colon, lung, peripheral blood leukocytes, placenta, small intestine, and thymus. Expressed at high levels in heart, kidney, liver, skeletal muscle and spleen. Overexpressed in a significant proportion
• Sequence:

  MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAA
  ELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFR
  PQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT

• Sequence length: 174

Pathways

Reactome Pathway:

Purine catabolism

Related Genes

No strongly related genes found yet for DNPH1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DNPH1.