DNM1P46 (dynamin 1 pseudogene 46)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 196968 |
| Gene name | Dynamin 1 pseudogene 46 |
| Gene symbol | DNM1P46 |
| Synonyms (NCBI Gene) |
C15orf51DNM1DN14.2DNM1DN14@
|
| Chromosome | 15 |
| Chromosome location | 15q26.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q6ZS02 |
| Protein name | Putative GED domain-containing protein DNM1P46 (DNM1 pseudogene 46) |
| Family and domains | |
| Sequence |
MLQLAGVSNSTCGGVRNVSVETRNVKPQGKDSKAEENGSHSFMHSMDPQLERQMETTQNL |
| Sequence length | 220 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with DNM1P46 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to DNM1P46 (see Related Genes above), that are NOT already directly curated for DNM1P46 itself -- a lead worth checking, not a confirmed association.
0
|
|