DNAJC4 (DnaJ heat shock protein family (Hsp40) member C4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3338
Gene name DnaJ heat shock protein family (Hsp40) member C4
Gene symbol DNAJC4
Synonyms (NCBI Gene)
DANJC4HSPF2MCG18
Chromosome 11
Chromosome location 11q13.1
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1978546 hsa-miR-1252 CLIP-seq
MIRT1978547 hsa-miR-4533 CLIP-seq
MIRT1978548 hsa-miR-4685-5p CLIP-seq
MIRT1978549 hsa-miR-4747-5p CLIP-seq
MIRT1978550 hsa-miR-542-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17500595, 32814053
GO:0006457 Process Protein folding NAS 9473517
GO:0006986 Process Response to unfolded protein TAS 9473517
GO:0016020 Component Membrane IEA
GO:0016020 Component Membrane NAS 9473517
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604189 5271 ENSG00000110011
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NNZ3
Protein name DnaJ homolog subfamily C member 4 (DnaJ-like protein HSPF2) (Multiple endocrine neoplasia type 1 candidate protein number 18)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 34 → 96 DnaJ domain Domain
Sequence 
MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKE
LHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQT
HSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQ
MHLNFMDEKDRIITAFYNEARARARANRGILQQERQRLGQRQPPPSEPTQGPEIVPRGAG
P
Sequence length 241
Interactions View interactions

No strongly related genes found yet for DNAJC4.

No additional diseases found yet through genes similar to DNAJC4.