DNAJB8 (DnaJ heat shock protein family (Hsp40) member B8)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 165721
• Gene name: DnaJ heat shock protein family (Hsp40) member B8
• Gene symbol: DNAJB8
• Synonyms (NCBI Gene): CT156, DJ6
• Chromosome: 3
• Chromosome location: 3q21.3
• Summary: The protein encoded by this gene belongs to the DNAJ/HSP40 family of proteins that regulate chaperone activity. This family member suppresses aggregation and toxicity of polyglutamine proteins, and the C-terminal tail is essential for this activity. It ha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021945	hsa-miR-128-3p	Microarray	17612493

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21231916
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	21231916
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	23612975
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0044183	Function	Protein folding chaperone	IBA
GO:0044183	Function	Protein folding chaperone	IDA	23612975
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IDA	21231916
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	IPI	21231916
GO:0090084	Process	Negative regulation of inclusion body assembly	IDA	21231916
GO:0090084	Process	Negative regulation of inclusion body assembly	IEA

Other IDs

• MIM: 611337
• HGNC: 23699
• e!Ensembl: ENSG00000179407

Protein

• UniProt ID: Q8NHS0
• Protein name: DnaJ homolog subfamily B member 8
• Protein function: Efficient suppressor of aggregation and toxicity of disease-associated polyglutamine proteins.
• PDB: 2DMX , 8DTS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00226	DnaJ	3 → 66	DnaJ domain	Domain

• Sequence:

  MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSK
  KRSLYDRAGCDSWRAGGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFN
  SDRGGRGHGLRGAFSAGFGEFPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK
  SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQLKWMDSK

• Sequence length: 232

Related Genes

No strongly related genes found yet for DNAJB8.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to DNAJB8.